protein 2K (NC_001474) Virus Tagged ORF Clone

CAT#: VC102554

  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for protein 2K [Dengue virus 2], codon optimized for human cell expression, NP_739593


  View other clones from "Virus" (13)

Reconstitution Protocol

USD 400.00

3 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Symbol protein 2K
Synonyms DENV_gp1, Dengue, DENV
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC102554 represents NCBI reference of NP_739593 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCCTCAGGACAATCAGCTTACATACGTCGTCATCGCAATACTTACAGTCGTCGCAGCTACCATGG
CC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC102554 representing NP_739593
Red=Cloning sites Green=Tags

MTPQDNQLTYVVIAILTVVAATMA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_001474
ORF Size 72 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Reference Data
RefSeq NC_001474.2, NP_739593
RefSeq ORF 72
MW 2.6 kDa

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.