protein 2K (NC_001474) Virus Tagged ORF Clone
CAT#: VC102554
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for protein 2K [Dengue virus 2], codon optimized for human cell expression, NP_739593
View other clones from "Virus" (13)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | protein 2K |
Synonyms | DENV_gp1, Dengue, DENV |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102554 represents NCBI reference of NP_739593 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACCCCTCAGGACAATCAGCTTACATACGTCGTCATCGCAATACTTACAGTCGTCGCAGCTACCATGG CC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102554 representing NP_739593
Red=Cloning sites Green=Tags MTPQDNQLTYVVIAILTVVAATMA myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001474 |
ORF Size | 72 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_001474.2, NP_739593 |
RefSeq ORF | 72 |
MW | 2.6 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102541 | Myc-DDK-tagged ORF clone of viral ORF for anchored capsid protein C [Dengue virus 2], codon optimized for human cell expression, NP_739581 |
USD 400.00 |
|
VC102542 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein C [Dengue virus 2], codon optimized for human cell expression, NP_739591 |
USD 400.00 |
|
VC102543 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein precursor M [Dengue virus 2], codon optimized for human cell expression, NP_739582 |
USD 400.00 |
|
VC102544 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein M [Dengue virus 2], codon optimized for human cell expression, NP_739592 |
USD 400.00 |
|
VC102545 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein E [Dengue virus 2], codon optimized for human cell expression, NP_739583 |
USD 610.00 |
|
VC102546 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS1 [Dengue virus 2], codon optimized for human cell expression, NP_739584 |
USD 440.00 |
|
VC102547 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2A [Dengue virus 2], codon optimized for human cell expression, NP_739585 |
USD 400.00 |
|
VC102548 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2B [Dengue virus 2], codon optimized for human cell expression, NP_739586 |
USD 400.00 |
|
VC102549 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS3 [Dengue virus 2], codon optimized for human cell expression, NP_739587 |
USD 770.00 |
|
VC102550 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4A [Dengue virus 2], codon optimized for human cell expression, NP_739588 |
USD 400.00 |
|
VC102551 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4B [Dengue virus 2], codon optimized for human cell expression, NP_739589 |
USD 400.00 |
|
VC102552 | Myc-DDK-tagged ORF clone of viral ORF for RNA-dependent RNA polymerase NS5 [Dengue virus 2], codon optimized for human cell expression, NP_739590 |
USD 1,390.00 |
|
VC102553 | Myc-DDK-tagged ORF clone of viral ORF for propein pr [Dengue virus 2], codon optimized for human cell expression, YP_009164954 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review