SARS-CoV-2 ORF10 Gene Tagged ORF Clone (Native Sequence)

CAT#: VC102572

Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF10 protein [Severe acute respiratory syndrome coronavirus 2], YP_009725255

Specifications

Product Data

• Tag: Myc-DDK
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >The Viral ORF clone VC202564 represents NCBI reference of YP_009725255
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
  GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
  ATGGGCTATATAAACGTTTTCGCTTTTCCGTTTACGATATATAGTCTACTCTTGTGCAGAATGAATTCT
  CGTAACTACATAGCACAAGTAGATGTAGTTAACTTTAATCTCACATAG
  
  Protein Sequence

  >VC102564 representing YP_009725255
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
  myc-FLAG tag
  
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• ACCN: NC_045512
• ORF Size: 114 bp
• OTI Disclaimer: The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NC_045512.2, YP_009725255
• RefSeq ORF: 114
• MW: 4.4 kDa