SARS-CoV-2 Orf10 Gene Tagged ORF Clone (Native Sequence)

CAT#: VC102586

mRFP-tagged ORF clone for SARS-CoV-2 ORF10 [Severe acute respiratory syndrome coronavirus 2], YP_009725255.1

Specifications

Product Data

• Tag: mRFP
• Symbol: ORF10
• Vector: pCMV6-AC-mRFP
• E. coli Selection: Ampicillin
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >The Viral ORF clone VC102586 represents NCBI reference of YP_009725255
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
  GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
  ATGGGCTATATAAACGTTTTCGCTTTTCCGTTTACGATATATAGTCTACTCTTGTGCAGAATGAATTCT
  CGTAACTACATAGCACAAGTAGATGTAGTTAACTTTAATCTCACAGCAGCAAATGATATCCTGGATTAC
  AAGGATGACGACGATAAGGTT
  ACGCGTACGCGGCCGCTCGAG - mRFP-Tag - TAA GTT TAA ACGGCCGGCCGCGG
  
  Protein Sequence

  >VC102586 representing YP_009725255
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLTAANDILDYKDDDDKV
  TRTRPLE - mRFP-Tag -
  
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• ACCN: NC_045512
• ORF Size: 159 bp
• OTI Disclaimer: The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NC_045512.2, YP_009725255.1
• RefSeq ORF: 159 bp
• MW: 6.1 kDa