SARS-CoV-2 Nsp8 Gene Tagged ORF Clone (Native Sequence)
CAT#: VC102578
- TrueORF®
mRFP-tagged ORF clone for SARS-CoV-2 NSP8 [Severe acute respiratory syndrome coronavirus 2], YP_009725304.1
View other clones from "SARS-CoV-2" (40)
Product Images
Specifications
Product Data | |
Tag | mRFP |
Symbol | NSP8 |
Vector | pCMV6-AC-mRFP |
E. coli Selection | Ampicillin |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102578 represents NCBI reference of YP_009725304
Blue=ORF Red=Cloning site Green=Tag(s) GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC ATGGCTATAGCCTCAGAGTTTAGTTCCCTTCCATCATATGCAGCTTTTGCTACTGCTCAAGAAGCTTAT GAGCAGGCTGTTGCTAATGGTGATTCTGAAGTTGTTCTTAAAAAGTTGAAGAAGTCTTTGAATGTGGCT AAATCTGAATTTGACCGTGATGCAGCCATGCAACGTAAGTTGGAAAAGATGGCTGATCAAGCTATGACC CAAATGTATAAACAGGCTAGATCTGAGGACAAGAGGGCAAAAGTTACTAGTGCTATGCAGACAATGCTT TTCACTATGCTTAGAAAGTTGGATAATGATGCACTCAACAACATTATCAACAATGCAAGAGATGGTTGT GTTCCCTTGAACATAATACCTCTTACAACAGCAGCCAAACTAATGGTTGTCATACCAGACTATAACACA TATAAAAATACGTGTGATGGTACAACATTTACTTATGCATCAGCATTGTGGGAAATCCAACAGGTTGTA GATGCAGATAGTAAAATTGTTCAACTTAGTGAAATTAGTATGGACAATTCACCTAATTTAGCATGGCCT CTTATTGTAACAGCTTTAAGGGCCAATTCTGCTGTCAAATTACAGGCAGCAAATGATATCCTGGATTAC AAGGATGACGACGATAAGGTT ACGCGTACGCGGCCGCTCGAG - mRFP-Tag - TAA GTT TAA ACGGCCGGCCGCGG >VC102578 representing YP_009725304
Blue=ORF Red=Cloning site Green=Tag(s) MAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMT QMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNT YKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQAANDILDY KDDDDKV TRTRPLE - mRFP-Tag - |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_045512 |
ORF Size | 642 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_045512.2, YP_009725304.1 |
RefSeq ORF | 642 bp |
MW | 23.7 kDa |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102555 | Myc-DDK-tagged ORF clone for SARS-CoV-2 nucleocapsid phosphoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724397 |
USD 400.00 |
|
VC102556 | Myc-DDK-tagged ORF clone for SARS-CoV-2 surface glycoprotein extracellular domain [Severe acute respiratory syndrome coronavirus 2], YP_009724390 |
USD 1,860.00 |
|
VC102557 | Myc-DDK-tagged ORF clone for SARS-CoV-2 surface glycoprotein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724390 |
USD 1,860.00 |
|
VC102558 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF3a protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724391 |
USD 400.00 |
|
VC102559 | Myc-DDK-tagged ORF clone for SARS-CoV-2 Membrane Glycoprotein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724393 |
USD 400.00 |
|
VC102560 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF6 protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724394 |
USD 400.00 |
|
VC102561 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF7a protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724395 |
USD 400.00 |
|
VC102562 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF8 protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724396 |
USD 400.00 |
|
VC102563 | Myc-DDK-tagged ORF clone for SARS-CoV-2 Nucleocapsid Phosphoprotein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724397 |
USD 400.00 |
|
VC102564 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF10 protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009725255 |
USD 400.00 |
|
VC102565 | Myc-DDK-tagged ORF clone for SARS-CoV-2 Envelop Protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724392 |
USD 400.00 |
|
VC202557 | Native cDNA clone for SARS-CoV-2 surface glycoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724390 |
USD 1,860.00 |
|
VC202558 | Native cDNA clone for SARS-CoV-2 ORF3a protein [Severe acute respiratory syndrome coronavirus 2], YP_009724391 |
USD 400.00 |
|
VC202559 | Native cDNA clone for SARS-CoV-2 Membrane Glycoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724393 |
USD 400.00 |
|
VC202560 | Native cDNA clone for SARS-CoV-2 ORF6 protein [Severe acute respiratory syndrome coronavirus 2], YP_009724394 |
USD 400.00 |
|
VC202561 | Native cDNA clone for SARS-CoV-2 ORF7a protein [Severe acute respiratory syndrome coronavirus 2], YP_009724395 |
USD 400.00 |
|
VC202562 | Native cDNA clone for SARS-CoV-2 ORF8 protein [Severe acute respiratory syndrome coronavirus 2], YP_009724396 |
USD 400.00 |
|
VC202563 | Native cDNA clone for SARS-CoV-2 Nucleocapsid Phosphoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724397 |
USD 400.00 |
|
VC202564 | Native cDNA clone for SARS-CoV-2 ORF10 protein [Severe acute respiratory syndrome coronavirus 2], YP_009725255 |
USD 400.00 |
|
VC202565 | Native cDNA clone for SARS-CoV-2 Envelop Protein [Severe acute respiratory syndrome coronavirus 2], YP_009724392 |
USD 400.00 |
|
VC102566 | Myc-DDK-tagged ORF clone for SARS-CoV-2 surface glycoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724390 |
USD 1,860.00 |
|
VC102567 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF3a protein [Severe acute respiratory syndrome coronavirus 2], YP_009724391 |
USD 400.00 |
|
VC102568 | Myc-DDK-tagged ORF clone for SARS-CoV-2 Membrane Glycoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724393 |
USD 400.00 |
|
VC102569 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF6 protein [Severe acute respiratory syndrome coronavirus 2], YP_009724394 |
USD 400.00 |
|
VC102570 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF7a protein [Severe acute respiratory syndrome coronavirus 2], YP_009724395 |
USD 400.00 |
|
VC102571 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF8 protein [Severe acute respiratory syndrome coronavirus 2], YP_009724396 |
USD 400.00 |
|
VC102572 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF10 protein [Severe acute respiratory syndrome coronavirus 2], YP_009725255 |
USD 400.00 |
|
VC102573 | Myc-DDK-tagged ORF clone for SARS-CoV-2 Envelop Protein [Severe acute respiratory syndrome coronavirus 2], YP_009724392 |
USD 400.00 |
|
VC102574 | mRFP-tagged ORF clone for SARS-CoV-2 NSP4 [Severe acute respiratory syndrome coronavirus 2], YP_009725300.1 |
USD 400.00 |
|
VC102575 | mRFP-tagged ORF clone for SARS-CoV-2 NSP5 [Severe acute respiratory syndrome coronavirus 2], YP_009725301.1 |
USD 400.00 |
|
VC102576 | mRFP-tagged ORF clone for SARS-CoV-2 NSP6 [Severe acute respiratory syndrome coronavirus 2], YP_009725302.1 |
USD 400.00 |
|
VC102577 | mRFP-tagged ORF clone for SARS-CoV-2 NSP7 [Severe acute respiratory syndrome coronavirus 2], YP_009725303.1 |
USD 400.00 |
|
VC102579 | mRFP-tagged ORF clone for SARS-CoV-2 NSP9 [Severe acute respiratory syndrome coronavirus 2], YP_009725305.1 |
USD 400.00 |
|
VC102580 | mRFP-tagged ORF clone for SARS-CoV-2 NSP10 [Severe acute respiratory syndrome coronavirus 2], YP_009725306.1 |
USD 400.00 |
|
VC102581 | mRFP-tagged ORF clone for SARS-CoV-2 NSP14 [Severe acute respiratory syndrome coronavirus 2], YP_009725309.1 |
USD 400.00 |
|
VC102582 | mRFP-tagged ORF clone for SARS-CoV-2 ORF3a [Severe acute respiratory syndrome coronavirus 2], YP_009724391.1 |
USD 400.00 |
|
VC102583 | mRFP-tagged ORF clone for SARS-CoV-2 M protein [Severe acute respiratory syndrome coronavirus 2], YP_009724393.1 |
USD 400.00 |
|
VC102584 | mRFP-tagged ORF clone for SARS-CoV-2 ORF9b [Severe acute respiratory syndrome coronavirus 2], YP_009724397.2 |
USD 400.00 |
|
VC102585 | mRFP-tagged ORF clone for SARS-CoV-2 ORF9c [Severe acute respiratory syndrome coronavirus 2], YP_009724397.2 |
USD 400.00 |
|
VC102586 | mRFP-tagged ORF clone for SARS-CoV-2 ORF10 [Severe acute respiratory syndrome coronavirus 2], YP_009725255.1 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review