Germany
Japan
United Kingdom
China
Primary Antibodies
EDG1 (S1PR1) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide derived from the C-terminal of the EDG-1 receptor |
Serotonin rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian, Snail |
Fibrinogen rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Immunogen | Native Mouse Fibrinogen. |
Borrelia burgdorferi rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Bacteria |
| Immunogen | Whole cell preparation from B. burgdorferi (Strain: B31 ATCC#35210) |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | A. victoria |
| Immunogen | Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
S1PR2 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 271-320 of Human EDG-5. |
Nidogen-2 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Mouse |
| Immunogen | Recombinant Mouse Nidogen 2 |
Sodium Iodide Symporter (SLC5A5) (C-term) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Porcine, Rat |
| Immunogen | Synthetic peptide from the C-terminus of Rat NIS |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Nidogen-2 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Mouse |
| Immunogen | Recombinant Mouse Nidogen 2 |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal Anti-GRSF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRSF1 antibody: synthetic peptide directed towards the middle region of human GRSF1. Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Hepatitis B Core Antigen / HBcAg rabbit polyclonal antibody, Ig Fraction
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Purified hepatitis B core antigen. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
IL21 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98%) E.coli derived recombinant human IL-21. |
TGF beta Receptor I (TGFBR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-200 of Human TGFβ RI. |
SLUG (SNAI2) (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SLUG. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Filter by
Target Symbol
- EGFR (112)
- MAPT (89)
- AKT1 (76)
- TP53 (72)
- RELA (64)
- H3C1 (63)
- RPS6KB1 (47)
- MAP2K1 (46)
- IRS1 (45)
- CTNNB1 (44)
- KDR (43)
- ERBB2 (42)
- APP (41)
- JUN (41)
- MAPK14 (40)
- CASP3 (38)
- FOXO1 (38)
- POMC (38)
- PTK2 (38)
- ESR1 (37)
- PRKAA1 (37)
- STAT1 (37)
- STAT3 (37)
- CREB1 (36)
- EIF4EBP1 (36)
- HSPB1 (36)
- RAF1 (36)
- BCL2 (35)
- NFKBIA (35)
- BRCA1 (34)
- S PROTEIN (34)
- SMAD2 (34)
- CHUK (33)
- GSK3B (33)
- RB1 (33)
- CHEK1 (31)
- HIF1A (31)
- HIST1H3A (31)
- MAPK8 (31)
- MYC (31)
- SMAD3 (31)
- SNCA (31)
- YAP1 (31)
- ALB (30)
- CASP9 (30)
- COL1A1 (30)
- NOS3 (30)
- PAK1 (30)
- SRC (30)
- EZR (29)
- GCG (29)
- IGF1R (29)
- MAP3K5 (29)
- MET (29)
- NFKB1 (29)
- ATF2 (28)
- CCNB1 (28)
- CDC25A (28)
- CDK1 (28)
- CHEK2 (28)
- GRIN1 (28)
- PDGFRB (28)
- SMAD1 (28)
- TNF (28)
- BAD (27)
- BAX (27)
- BRAF (27)
- JAK2 (27)
- MAPK1 (27)
- NPPA (27)
- NPPB (27)
- NR3C1 (27)
- PIK3R1 (27)
- PRKCA (27)
- UBB (27)
- CDKN2A (26)
- CSF1R (26)
- EDN1 (26)
- H3-4 (26)
- MTOR (26)
- PRKCD (26)
- PXN (26)
- VEGFA (26)
- ABL1 (25)
- CD44 (25)
- CDH1 (25)
- GRIN2B (25)
- IL1B (25)
- PTEN (25)
- STMN1 (25)
- VIM (25)
- CALCA (24)
- GSK3A (24)
- HISTONE H3 (24)
- IL4 (24)
- SYN1 (24)
- FGFR1 (23)
- GAPDH (23)
- IGF1 (23)
- IKBKG (23)
Reactivities
- Human (61053)
- Mouse (33495)
- Rat (23797)
- Bovine (997)
- Monkey (521)
- Chicken (349)
- Pig (349)
- Dog (294)
- Rabbit (262)
- Hamster (232)
- Xenopus (222)
- Rhesus Monkey (168)
- Gorilla (157)
- Primate (155)
- Zebrafish (147)
- Mammalian (142)
- Horse (141)
- Chimpanzee (136)
- Porcine (131)
- Gibbon (122)
- Bat (108)
- X. tropicalis (101)
- Murine (78)
- Canine (76)
- SARS-CoV-2 (60)
- Guinea Pig (59)
- Sheep (59)
- Cow (50)
- Drosophila (43)
- Orang-Utan (38)
- Other (Wide Range) (34)
- Feline (32)
- Broad (26)
- Macaque (20)
- Equine (18)
- Canis (12)
- Goat (12)
- C-term DDK (10)
- Avian (8)
- C. elegans (8)
- Fish (8)
- Yeast (8)
- Gerbil (7)
- SARS-CoV (7)
- Opossum (6)
- All Species (5)
- Escherichia coli (4)
- Quail (4)
- Baboon (3)
- EV-71 (3)
- Frog (3)
- Fusion proteins containing the Flag Tag (3)
- HCoV-HKU1 (3)
- HCoV-OC43 (3)
- Invertebrate (3)
- Saccharomyces cerevisiae (3)
- Turkey (3)
- Arabidopsis (2)
- Coral (2)
- Cynomolgus (2)
- Ferret (2)
- Fungus (2)
- HCoV-229E (2)
- Pufferfish (2)
- Streptococcus Pyogenes (2)
- 5-FAM (1)
- Algal (1)
- Amphibian (1)
- Beluga (1)
- Biotin (1)
- Birds (1)
- Carp (1)
- Dengue virus (1)
- Digoxin (1)
- Dogfish (1)
- Drosophila melanogaster (1)
- Eukaryote (1)
- FITC (1)
- HCoV-NL63 (1)
- HIV (1)
- Hagfish (1)
- Horseradish Peroxidase (1)
- Insect (1)
- Marmoset (1)
- Medaka fish (1)
- Mink (1)
- Mustelid (1)
- Protozoa (1)
- Respiratory Syncytial Virus (1)
- SimianIVE (1)
- Staphylococcus aureus (1)
- Tadpole (1)
- Tobacco (1)
- Tobacco hornworm (1)
- Tomato (1)
- Virus (1)
- West Nile Virus (1)
- Yellow Fever Virus (1)
Applications
- WB (69766)
- IHC (33280)
- IF (10636)
- ELISA (7159)
- IP (2435)
- FC (1891)
- ICC/IF (620)
- R (591)
- ID (478)
- FN (277)
- Dot (132)
- Assay (120)
- ChIP (115)
- Bl (44)
- SISCAPA (35)
- CT (26)
- EMSA (21)
- Neutralize (14)
- AP (13)
- EM (12)
- 10k-ChIP (11)
- ICC (11)
- NEUT (9)
- Inhib (6)
- LMNX (6)
- AGG (3)
- Ie (3)
- IHC-F (2)
- IHC-P (2)
- P (2)
- E(capture) (1)
- EIA (1)
- Func (1)
- LF (1)
- RID (1)
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (9273)
- Phospho-specific (1472)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (94)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (36)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (27)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (23)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (20)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (18)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. (17)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (14)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (14)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (8)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (7)
- Phospho S83 (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (6)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (6)
- Acetyl K5 (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original VHH format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgM format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (4)
- Phospho S15 (3)
- Phospho S166 (3)
- Phospho S376 (3)
- Phospho T286 (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG2 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgM format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- This is a chimeric antibody created as part of a panel offering antibodies of the same specificity in different formats (species, isotype, subtype and modified versions) for use as isotype controls. (3)
- Acetyl K12 (2)
- Acetyl K16 (2)
- Acetyl K27 (2)
- Acetyl K36 (2)
- Acetyl K4 (2)
- MonoMethyl K342 (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- Phospho S104 (2)
- Phospho S127 (2)
- Phospho S128 (2)
- Phospho S129 (2)
- Phospho S139 (2)
- Phospho S16 (2)
- Phospho S176/180 (2)
- Phospho S21 (2)
- Phospho S319 (2)
- Phospho S345 (2)
- Phospho S366 (2)
- Phospho S37 (2)
- Phospho S380 (2)
- Phospho S39 (2)
- Phospho S396 (2)
- Phospho S56 (2)
- Phospho S616 (2)
- Phospho S727 (2)
- Phospho S795 (2)
- Phospho S89 (2)
- Phospho S9 (2)
- Phospho T183/T172 (2)
- Phospho T187 (2)
- Phospho T389 (2)
- Phospho T514 (2)
- Phospho Y410 (2)
- Phospho Y779 (2)
- Phospho Y925 (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K262/K265/K274 (1)
- Acetyl K29 (1)
- Acetyl K332 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- K11-linkage Specific Polyubiquitin (1)
- K27-linkage Specific Polyubiquitin (1)
- K29-linkage Specific Polyubiquitin (1)
- K33-linkage Specific Polyubiquitin (1)
- K48-linkage Specific Polyubiquitin (1)
- K6-linkage Specific Polyubiquitin (1)
- K63-linkage Specific Polyubiquitin (1)
- M1-linkage Specific Polyubiquitin (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho 180/Y182,Phospho T180/Y182,Phospho T180/Y182,Phospho T183/Y1845 (1)
- Phospho Phospho S87 (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S102 (1)
- Phospho S1033 (1)
- Phospho S11 (1)
- Phospho S1105 (1)
- Phospho S1108 (1)
- Phospho S112 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S1387 (1)
- Phospho S1490 (1)
- Phospho S157 (1)
- Phospho S16/T17 (1)
- Phospho S17 (1)
- Phospho S172 (1)
- Phospho S176 (1)
- Phospho S180 (1)
- Phospho S182 (1)
- Phospho S189,Phospho S207 (1)
- Phospho S19 (1)
- Phospho S194 (1)
- Phospho S1943 (1)
- Phospho S1981 (1)
- Phospho S199/S204 (1)
- Phospho S2 (1)
- Phospho S20 (1)
- Phospho S202 (1)
- Phospho S2056 (1)
- Phospho S209 (1)
- Phospho S211 (1)
- Phospho S2152 (1)
- Phospho S217 (1)
- Phospho S22 (1)
- Phospho S235/236 (1)
- Phospho S240/244 (1)
- Phospho S241 (1)
- Phospho S243 (1)
- Phospho S2448 (1)
- Phospho S2481 (1)
- Phospho S253 (1)
- Phospho S257 (1)
- Phospho S257/T261 (1)
- Phospho S259 (1)
- Phospho S271 (1)
- Phospho S271/T275 (1)
- Phospho S28 (1)
- Phospho S280 (1)
- Phospho S29/33/37/T41 (1)
- Phospho S291 (1)
- Phospho S293 (1)
- Phospho S294 (1)
- Phospho S296 (1)
- Phospho S298 (1)
- Phospho S299 (1)
- Phospho S304 (1)
- Phospho S307 (1)
- Phospho S308,Phospho S309,Phospho S305 (1)
- Phospho S32 (1)
- Phospho S32/S36 (1)
- Phospho S320 (1)
- Phospho S323 (1)
- Phospho S326 (1)
- Phospho S33 (1)
- Phospho S33/35 (1)
- Phospho S33/S37/T41 (1)
- Phospho S330 (1)
- Phospho S334 (1)
- Phospho S338 (1)
- Phospho S358 (1)
- Phospho S36 (1)
- Phospho S365 (1)
- Phospho S380/T382/383 (1)
- Phospho S386 (1)
- Phospho S392 (1)
- Phospho S397 (1)
- Phospho S4/S8 (1)
- Phospho S40 (1)
- Phospho S409/S410 (1)
- Phospho S412 (1)
- Phospho S420 (1)
- Phospho S422 (1)
- Phospho S423/S425 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S445 (1)
- Phospho S448 (1)
- Phospho S45 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S465/S467 (1)
- Phospho S467 (1)
- Phospho S471/472 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S474 (1)
- Phospho S483 (1)
- Phospho S485 (1)
- Phospho S5 (1)
- Phospho S505 (1)
- Phospho S507 (1)
- Phospho S51 (1)
- Phospho S516 (1)
- Phospho S519/T522 (1)
- Phospho S529 (1)
- Phospho S552 (1)
- Phospho S555 (1)
- Phospho S563 (1)
- Phospho S588 (1)
- Phospho S6 (1)
- Phospho S608 (1)
- Phospho S611/615 (1)
- Phospho S611/615/616 (1)
- Phospho S612 (1)
- Phospho S615 (1)
- Phospho S62 (1)
- Phospho S621 (1)
- Phospho S63 (1)
- Phospho S636/639 (1)
- Phospho S637 (1)
- Phospho S638 (1)
- Phospho S641 (1)
- Phospho S643/676 (1)
- Phospho S645 (1)
- Phospho S65 (1)
- Phospho S657/Y658 (1)
- Phospho S660 (1)
- Phospho S668 (1)
- Phospho S675 (1)
- Phospho S7 (1)
- Phospho S70 (1)
- Phospho S71 (1)
- Phospho S728 (1)
- Phospho S73 (1)
- Phospho S744/748 (1)
- Phospho S757 (1)
- Phospho S80 (1)
- Phospho S807/811 (1)
- Phospho S811 (1)
- Phospho S82 (1)
- Phospho S838/S840 (1)
- Phospho S845 (1)
- Phospho S886 (1)
- Phospho S890 (1)
- Phospho S896/S897 (1)
- Phospho S897 (1)
- Phospho S916 (1)
- Phospho S932 (1)
- Phospho S957 (1)
- Phospho S967 (1)
- Phospho Ser15 (1)
- Phospho Ser198/Ser199/Ser202 (1)
- Phospho Ser355 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho Ser551 (1)
- Phospho Ser729 (1)
- Phospho Ser792 (1)
- Phospho Ser90 (1)
- Phospho T11 (1)
- Phospho T117 (1)
- Phospho T14 (1)
- Phospho T1462 (1)
- Phospho T156 (1)
- Phospho T163 (1)
- Phospho T17 (1)
- Phospho T172 (1)
- Phospho T179 (1)
- Phospho T18 (1)
- Phospho T18/S19 (1)
- Phospho T180/T183 (1)
- Phospho T180/Y182 (1)
- Phospho T180/Y182 + T183/Y1845 (1)
- Phospho T181 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T184/T187 (1)
- Phospho T186 (1)
- Phospho T189 (1)
- Phospho T197 (1)
- Phospho T197/202 (1)
- Phospho T1989 (1)
- Phospho T199 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T202/Y204+T185/Y187 (1)
- Phospho T204 (1)
- Phospho T210 (1)
- Phospho T212 (1)
- Phospho T217 (1)
- Phospho T23 (1)
- Phospho T231 (1)
- Phospho T231/S232 (1)
- Phospho T232 (1)
- Phospho T235 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T246 (1)
- Phospho T261 (1)
- Phospho T288 (1)
- Phospho T288,Phospho T232,Phospho T198 (1)
- Phospho T292 (1)
- Phospho T3 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T334 (1)
- Phospho T346 (1)
- Phospho T357/S358/S360 (1)
- Phospho T359 (1)
- Phospho T359/S363 (1)
- Phospho T37/46 (1)
- Phospho T384 (1)
- Phospho T387 (1)
- Phospho T395 (1)
- Phospho T410 (1)
- Phospho T421/S424 (1)
- Phospho T434 (1)
- Phospho T446 (1)
- Phospho T45 (1)
- Phospho T495 (1)
- Phospho T498 (1)
- Phospho T505 (1)
- Phospho T508/T505 (1)
- Phospho T538 (1)
- Phospho T543 (1)
- Phospho T56 (1)
- Phospho T567,Phospho T564,Phospho T558 (1)
- Phospho T573 (1)
- Phospho T58 (1)
- Phospho T581 (1)
- Phospho T6 (1)
- Phospho T641 (1)
- Phospho T642 (1)
- Phospho T668 (1)
- Phospho T669 (1)
- Phospho T678 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T696 (1)
- Phospho T70 (1)
- Phospho T81 (1)
- Phospho T845 (1)
- Phospho T853 (1)
- Phospho T91 (1)
- Phospho T918 (1)
- Phospho T93 (1)
- Phospho T982 (1)
- Phospho Thr212/Ser214 (1)
- Phospho Thr421 (1)
- Phospho Y10 (1)
- Phospho Y1007 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1008 (1)
- Phospho Y1018 (1)
- Phospho Y1020 (1)
- Phospho Y1021 (1)
- Phospho Y1022/1023 (1)
- Phospho Y1045 (1)
- Phospho Y1054/1055 (1)
- Phospho Y1068 (1)
- Phospho Y1070 (1)
- Phospho Y1086 (1)
- Phospho Y1096 (1)
- Phospho Y1148 (1)
- Phospho Y1165/1166,Phospho Y1189/1190 (1)
- Phospho Y1173 (1)
- Phospho Y1175 (1)
- Phospho Y1189/Y1190,Phospho Y1165/Y1166 (1)
- Phospho Y1217 (1)
- Phospho Y1221/1222 (1)
- Phospho Y1234/1235 (1)
- Phospho Y1248 (1)
- Phospho Y1284 (1)
- Phospho Y133 (1)
- Phospho Y1349 (1)
- Phospho Y1361 (1)
- Phospho Y138 (1)
- Phospho Y139 (1)
- Phospho Y14 (1)
- Phospho Y145 (1)
- Phospho Y1474 (1)
- Phospho Y15 (1)
- Phospho Y165 (1)
- Phospho Y171 (1)
- Phospho Y177 (1)
- Phospho Y182 (1)
- Phospho Y191 (1)
- Phospho Y204 (1)
- Phospho Y207 (1)
- Phospho Y216 (1)
- Phospho Y221 (1)
- Phospho Y232 (1)
- Phospho Y245 (1)
- Phospho Y284 (1)
- Phospho Y291 (1)
- Phospho Y292 (1)
- Phospho Y307 (1)
- Phospho Y311 (1)
- Phospho Y317 (1)
- Phospho Y322 (1)
- Phospho Y323 (1)
- Phospho Y340 (1)
- Phospho Y353 (1)
- Phospho Y397 (1)
- Phospho Y402 (1)
- Phospho Y412 (1)
- Phospho Y416 (1)
- Phospho Y416/Y416 (1)
- Phospho Y467/Y199/Y464 (1)
- Phospho Y564 (1)
- Phospho Y576/577 (1)
- Phospho Y589/591 (1)
- Phospho Y594 (1)
- Phospho Y653 (1)
- Phospho Y659 (1)
- Phospho Y674/675 + Y706/707 (1)
- Phospho Y694 (1)
- Phospho Y699 (1)
- Phospho Y700 (1)
- Phospho Y705 (1)
- Phospho Y708 (1)
- Phospho Y719 (1)
- Phospho Y723 (1)
- Phospho Y724 (1)
- Phospho Y731 (1)
- Phospho Y751 (1)
- Phospho Y754 (1)
- Phospho Y759 (1)
- Phospho Y771 (1)
- Phospho Y789 (1)
- Phospho Y792 (1)
- Phospho Y845 (1)
- Phospho Y849 (1)
- Phospho Y869 (1)
- Phospho Y980/981 (1)
- Phospho Y992 (1)
- Phospho Y996 (1)
- Phospho Y998 (1)
- Phospho pS221 (1)
- Phospho s724 (1)
- Phospho-(Ser/Thr) (1)
- Phospho-PKC (pan) (βII Ser660) (1)
- Phospho-RPS6KB1-S371 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Chicken scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- Ubiquityl K119 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
- monoMethyl E105 (1)
- pan Phospho-Serine/Threonine (1)
- pan Symmetric-DiMethyl-Arginine (1)
- pan-Di-Methyl K (1)
- pan-Mono-Methyl K (1)
- pan-Mono-MethylR（R*GG） (1)
- pan-Myristyl-G (1)
- pan-Phospho-Serine (1)
- pan-TriMethyl-lysine (1)
- pan-tri-Methyl K (1)
- phospho S76 (1)
- phospho T1079,Phospho T1041 (1)
- succinylation K79 (1)
Assay Types
Assay Platforms
Families
- Druggable Genome (23228)
- Transmembrane (10933)
- Transcription Factors (6550)
- Secreted Protein (3629)
- Protein Kinase (2774)
- ES Cell Differentiation/IPS (2277)
- Stem cell - Pluripotency (1482)
- GPCR (1360)
- Protease (1338)
- Adult stem cells (530)
- Embryonic stem cells (441)
- Phosphatase (420)
- Cancer stem cells (373)
- Nuclear Hormone Receptor (372)
- Ion Channels: Other (312)
- Stem cell relevant signaling - JAK/STAT signaling pathway (307)
- Induced pluripotent stem cells (271)
- Ion Channels: Potassium (197)
- P450 (177)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (159)
- Stem cell relevant signaling - DSL/Notch pathway (142)
- Stem cell relevant signaling - Wnt Signaling pathway (135)
- Ion Channels: Cys-loop Receptors (121)
- Ion Channels: Glutamate Receptors (107)
- Ion Channels: Transient receptor potential (106)
- Ion Channels: Sodium (40)
- Ion Channels: ATP Receptors (24)
- Ion Channels: Cyclic nucleotide gated (18)
- Ion Channels: Calcium (14)
Pathways
- Pathways in cancer (2865)
- Metabolic pathways (2824)
- MAPK signaling pathway (1864)
- Focal adhesion (1516)
- Cytokine-cytokine receptor interaction (1440)
- Neuroactive ligand-receptor interaction (1256)
- Chemokine signaling pathway (1203)
- Prostate cancer (1175)
- Neurotrophin signaling pathway (1174)
- Regulation of actin cytoskeleton (1142)
- ErbB signaling pathway (979)
- Colorectal cancer (959)
- Pancreatic cancer (951)
- Insulin signaling pathway (940)
- Cell cycle (934)
- Chronic myeloid leukemia (923)
- Jak-STAT signaling pathway (908)
- T cell receptor signaling pathway (907)
- Calcium signaling pathway (878)
- Wnt signaling pathway (864)
- Endocytosis (846)
- Apoptosis (842)
- Small cell lung cancer (837)
- Toll-like receptor signaling pathway (835)
- Alzheimer's disease (801)
- Leukocyte transendothelial migration (768)
- Melanoma (763)
- Acute myeloid leukemia (746)
- Glioma (729)
- Progesterone-mediated oocyte maturation (706)
- Huntington's disease (700)
- Natural killer cell mediated cytotoxicity (699)
- Endometrial cancer (688)
- Non-small cell lung cancer (674)
- Adipocytokine signaling pathway (666)
- B cell receptor signaling pathway (663)
- Fc gamma R-mediated phagocytosis (660)
- VEGF signaling pathway (644)
- Adherens junction (634)
- Tight junction (622)
- GnRH signaling pathway (620)
- Axon guidance (617)
- Renal cell carcinoma (609)
- Melanogenesis (606)
- Epithelial cell signaling in Helicobacter pylori infection (597)
- Oocyte meiosis (595)
- p53 signaling pathway (593)
- Gap junction (584)
- Fc epsilon RI signaling pathway (562)
- Olfactory transduction (547)
- Bladder cancer (543)
- TGF-beta signaling pathway (531)
- Amyotrophic lateral sclerosis (ALS) (523)
- NOD-like receptor signaling pathway (521)
- Ubiquitin mediated proteolysis (512)
- Vascular smooth muscle contraction (508)
- mTOR signaling pathway (496)
- Cell adhesion molecules (CAMs) (477)
- RIG-I-like receptor signaling pathway (472)
- Hematopoietic cell lineage (449)
- Long-term potentiation (436)
- Parkinson's disease (429)
- Long-term depression (417)
- Systemic lupus erythematosus (406)
- Pathogenic Escherichia coli infection (388)
- Purine metabolism (388)
- Hypertrophic cardiomyopathy (HCM) (373)
- Dilated cardiomyopathy (372)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (361)
- Basal cell carcinoma (335)
- Cytosolic DNA-sensing pathway (335)
- Type II diabetes mellitus (327)
- ECM-receptor interaction (324)
- Thyroid cancer (313)
- Viral myocarditis (312)
- Spliceosome (293)
- Antigen processing and presentation (290)
- PPAR signaling pathway (284)
- Complement and coagulation cascades (280)
- Lysosome (280)
- Glycolysis / Gluconeogenesis (266)
- Prion diseases (249)
- Oxidative phosphorylation (244)
- Hedgehog signaling pathway (239)
- Notch signaling pathway (228)
- Pyrimidine metabolism (218)
- Dorso-ventral axis formation (217)
- Phosphatidylinositol signaling system (217)
- Drug metabolism - cytochrome P450 (215)
- Ribosome (215)
- Vibrio cholerae infection (213)
- Metabolism of xenobiotics by cytochrome P450 (210)
- Primary immunodeficiency (198)
- Arginine and proline metabolism (197)
- Cardiac muscle contraction (189)
- Type I diabetes mellitus (173)
- Nucleotide excision repair (172)
- Arachidonic acid metabolism (169)
- Tyrosine metabolism (165)
- Valine (164)
- Retinol metabolism (163)
- RNA degradation (149)
- Allograft rejection (148)
- Autoimmune thyroid disease (148)
- Pyruvate metabolism (148)
- Glycerophospholipid metabolism (146)
- Graft-versus-host disease (145)
- Base excision repair (143)
- Tryptophan metabolism (142)
- leucine and isoleucine degradation (140)
- Glycerolipid metabolism (138)
- Inositol phosphate metabolism (138)
- Fatty acid metabolism (136)
- Proteasome (135)
- Regulation of autophagy (135)
- Homologous recombination (132)
- Drug metabolism - other enzymes (127)
- ABC transporters (126)
- DNA replication (126)
- Glutathione metabolism (125)
- Maturity onset diabetes of the young (124)
- Alanine (121)
- aspartate and glutamate metabolism (121)
- Fructose and mannose metabolism (119)
- Starch and sucrose metabolism (119)
- Lysine degradation (118)
- Sphingolipid metabolism (118)
- Amino sugar and nucleotide sugar metabolism (117)
- Butanoate metabolism (115)
- Cysteine and methionine metabolism (115)
- Citrate cycle (TCA cycle) (108)
- Taste transduction (106)
- Basal transcription factors (105)
- Asthma (104)
- Mismatch repair (98)
- Porphyrin and chlorophyll metabolism (97)
- Androgen and estrogen metabolism (95)
- Propanoate metabolism (90)
- Histidine metabolism (87)
- Glycine (85)
- serine and threonine metabolism (85)
- Galactose metabolism (82)
- Non-homologous end-joining (82)
- SNARE interactions in vesicular transport (81)
- Renin-angiotensin system (77)
- Linoleic acid metabolism (76)
- Nitrogen metabolism (76)
- Pentose phosphate pathway (76)
- Phenylalanine metabolism (75)
- Ether lipid metabolism (73)
- N-Glycan biosynthesis (69)
- beta-Alanine metabolism (67)
- Aminoacyl-tRNA biosynthesis (66)
- Nicotinate and nicotinamide metabolism (65)
- Biosynthesis of unsaturated fatty acids (60)
- RNA polymerase (57)
- Selenoamino acid metabolism (53)
- Primary bile acid biosynthesis (52)
- O-Glycan biosynthesis (50)
- Pentose and glucuronate interconversions (49)
- Glycosaminoglycan degradation (48)
- Riboflavin metabolism (48)
- Ascorbate and aldarate metabolism (47)
- Terpenoid backbone biosynthesis (47)
- Circadian rhythm - mammal (45)
- Glyoxylate and dicarboxylate metabolism (43)
- Limonene and pinene degradation (42)
- Glycosphingolipid biosynthesis - lacto and neolacto series (40)
- Folate biosynthesis (39)
- Heparan sulfate biosynthesis (38)
- Chondroitin sulfate biosynthesis (37)
- C21-Steroid hormone metabolism (36)
- Taurine and hypotaurine metabolism (34)
- Other glycan degradation (33)
- alpha-Linolenic acid metabolism (33)
- One carbon pool by folate (32)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (31)
- leucine and isoleucine biosynthesis (31)
- Pantothenate and CoA biosynthesis (30)
- Caffeine metabolism (29)
- Keratan sulfate biosynthesis (29)
- Synthesis and degradation of ketone bodies (29)
- Steroid biosynthesis (27)
- Glycosphingolipid biosynthesis - ganglio series (24)
- Methane metabolism (24)
- Sulfur metabolism (24)
- Glycosphingolipid biosynthesis - globo series (22)
- Fatty acid elongation in mitochondria (20)
- Phenylalanine (17)
- tyrosine and tryptophan biosynthesis (17)
- Fatty acid biosynthesis (16)
- Thiamine metabolism (16)
- Cyanoamino acid metabolism (15)
- Lysine biosynthesis (15)
- Protein export (15)
- Ubiquinone and other terpenoid-quinone biosynthesis (14)
- Vitamin B6 metabolism (14)
- D-Glutamine and D-glutamate metabolism (11)
- Lipoic acid metabolism (6)
- O-Mannosyl glycan biosynthesis (6)
- D-Arginine and D-ornithine metabolism (1)