Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Active filters
Reactivities
- Mouse
Applications
- IHC
Clonalities
- Polyclonal
Pathways
- Pathways in cancer
Filter by
Category
Target Symbol
- AKT1 (20)
- STAT1 (11)
- HDAC2 (10)
- RELA (10)
- BAD (8)
- BAX (8)
- BRAF (8)
- CASP9 (8)
- NFKBIA (8)
- SMAD3 (8)
- CASP3 (7)
- FOS (7)
- HSP90AB1 (7)
- JUN (7)
- JUP (7)
- STAT3 (7)
- STAT5B (7)
- BCL2L1 (6)
- CHUK (6)
- FOXO1 (6)
- BIRC5 (5)
- CDK6 (5)
- CTBP1 (5)
- CTBP2 (5)
- FGFR3 (5)
- HDAC1 (5)
- JAK1 (5)
- PIAS2 (5)
- PPARG (5)
- PRKCA (5)
- PTEN (5)
- RAF1 (5)
- TP53 (5)
- TRAF2 (5)
- AKT2 (4)
- AKT3 (4)
- CCNA1 (4)
- CCNE1 (4)
- CDH1 (4)
- CSF1R (4)
- CTNNA1 (4)
- CTNNB1 (4)
- EGFR (4)
- ERBB2 (4)
- FGFR2 (4)
- GSK3B (4)
- HIF1A (4)
- HSP90AA1 (4)
- IGF1R (4)
- IKBKG (4)
- MAPK1 (4)
- MMP2 (4)
- MTOR (4)
- MYC (4)
- NTRK1 (4)
- PIK3R1 (4)
- RB1 (4)
- SHH (4)
- SLC2A1 (4)
- SMAD4 (4)
- TRAF6 (4)
- ABL1 (3)
- ACVR1C (3)
- APC (3)
- BCL2 (3)
- BID (3)
- BIRC2 (3)
- CCND1 (3)
- CDKN1A (3)
- CEBPA (3)
- COL4A1 (3)
- CYCS (3)
- EGLN1 (3)
- FADD (3)
- FN1 (3)
- FZD8 (3)
- GRB2 (3)
- GSTP1 (3)
- HSP90B1 (3)
- LAMA1 (3)
- MAP2K1 (3)
- MAP2K2 (3)
- MAPK8 (3)
- MMP9 (3)
- MSH6 (3)
- NFKB1 (3)
- NFKB2 (3)
- NOS2 (3)
- PAX8 (3)
- PDGFRB (3)
- PIAS1 (3)
- RAD51 (3)
- RARA (3)
- RASSF1 (3)
- TGFB1 (3)
- TGFBR1 (3)
- TGFBR2 (3)
- TRAF3 (3)
- WNT10A (3)
- WNT10B (3)
Antibody Hosts
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (631)
- Transcription Factors (186)
- ES Cell Differentiation/IPS (165)
- Protein Kinase (162)
- Transmembrane (138)
- Secreted Protein (96)
- Stem cell - Pluripotency (73)
- Adult stem cells (35)
- Stem cell relevant signaling - JAK/STAT signaling pathway (35)
- Cancer stem cells (32)
- Embryonic stem cells (28)
- Protease (28)
- Stem cell relevant signaling - Wnt Signaling pathway (26)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (17)
- Stem cell relevant signaling - DSL/Notch pathway (16)
- Nuclear Hormone Receptor (15)
- Induced pluripotent stem cells (14)
- GPCR (10)
- Phosphatase (5)