Primary Antibodies

View as table Download

Rabbit anti-HSPA9 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPA9

Rabbit anti-ENO1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ENO1

Rabbit Polyclonal Anti-WDR61 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen WDR61 antibody was raised against a 14 amino acid peptide near the amino terminus of human WDR61.

Rabbit Polyclonal Anti-SLC1A7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SLC1A7 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human SLC1A7.

Rabbit Polyclonal Anti-EXOSC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC4 antibody: synthetic peptide directed towards the N terminal of human EXOSC4. Synthetic peptide located within the following region: SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE

Rabbit Polyclonal Anti-LSM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM2 antibody: synthetic peptide directed towards the middle region of human LSM2. Synthetic peptide located within the following region: TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Rabbit Polyclonal Anti-EXOSC6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK

Rabbit Polyclonal Anti-WNT5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen WNT5 antibody was raised against a 15 amino acid peptide near the center of human WNT5B.

Rabbit anti-HSPD1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPD1

Rabbit Polyclonal Anti-LSM4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM4 antibody: synthetic peptide directed towards the middle region of human LSM4. Synthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK

Rabbit Polyclonal Anti-EXOSC2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the N terminal of human EXOSC2. Synthetic peptide located within the following region: RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV

Rabbit Polyclonal Anti-EXOSC7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD

Rabbit Polyclonal Anti-EXOSC7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC

Rabbit Polyclonal Anti-EXOSC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Rabbit Polyclonal Anti-EXOSC10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C terminal of human EXOSC10. Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG

Rabbit Polyclonal Anti-EXOSC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the middle region of human EXOSC3. Synthetic peptide located within the following region: TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK

Rabbit Polyclonal Anti-ENO3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR

Rabbit anti-MTR4 Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MTR4

Non Neuronal Enolase (ENO1) (178-205) rabbit polyclonal antibody, Ig Fraction

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1.

Hsp60 (HSPD1) goat polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Bacteria, Bovine, Canine, Drosophila, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus
Immunogen HSPD1 antibody was raised against recombinant human HSP60.

Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8)

Rabbit polyclonal anti-NSE / ENO2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NSE.

Rabbit polyclonal anti-HSP60 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP60.

NSE (ENO2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide mapping at the C-terminus of NSE of human origin

Grp75 (HSPA9) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to C-Terminus of Human GRP75.

NSE (ENO2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human NSE.
Epitope: C-terminus.

Hsp60 (HSPD1) rabbit polyclonal antibody

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Hsp60 (HSPD1) rabbit polyclonal antibody

Applications FC, IF, IHC, WB
Reactivities Mouse, Primate, Rat
Conjugation Unconjugated

Rabbit Polyclonal antibody to ENO1 (enolase 1, (alpha))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 434 of ENO1 (Uniprot ID#P06733)

Rabbit polyclonal CAF-1 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1.

Rabbit polyclonal CNOT8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CNOT8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from the C-terminal region of human CNOT8.

Rabbit polyclonal ENO1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1.

Rabbit Polyclonal HSP60 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Hamster, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809]

Rabbit Polyclonal Anti-PNPT1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNPT1 antibody: synthetic peptide directed towards the middle region of human PNPT1. Synthetic peptide located within the following region: CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED

Hsp60 (HSPD1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide mapping at the middle region of human HSP60

NSE (ENO2) chicken polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Chickens were immunized with two synthetic peptide KLH conjugates corresponding to different regions of the NSE-2 gene product, but are shared between the Human (NP_001966, NCBI) and Rat (AAA41119) sequences.
Production: After repeated injections into the hens, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity-purified using a peptide column, and the concentrations of the eluates adjusted to 0.2 mg/ml. Finally, equal volumes of each of these affinity-purified anti-peptide antibodies were mixed, and the preparation was filter-sterilized.

DCP2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 151~181 amino acids from the Center region of Human DCP2

PATL1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 496~526 amino acids from the C-terminal region of human PATL1

Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 783 of PNPase (Uniprot ID#Q8TCS8)

Rabbit Polyclonal Exosome Component 9 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human EXOSC9 protein (within residues 250-439). [Swiss-Prot Q06265]

Rabbit polyclonal CNOT2 (Ser101) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G).
Modifications Phospho-specific

Rabbit polyclonal anti-PNPT1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PNPT1.

Rabbit Polyclonal DIS3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DIS3 antibody was raised against an 18 amino acid peptide near the amino terminus of human DIS3.

Rabbit polyclonal HSPD1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1.

Rabbit Polyclonal anti-HSPA9 antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP

Rabbit Polyclonal HSP60 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Hamster, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809]

DCP1A rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 102-150 of Human SMIF.

CNOT4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat