Primary Antibodies

View as table Download

EGFR L858R mouse monoclonal antibody,clone UMAB233

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Monoclonal antibody against Gli-1 (GLI1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

HDAC1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen N term -peptide of human HDAC1

Rabbit Polyclonal Gli1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151]

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-HGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HGF

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LEF1

BMP4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide surrounding amino acid 395 of Human BMP-4

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit polyclonal anti-Gli-3 antibody

Applications IF, IHC, WB
Reactivities Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein.

Rabbit Polyclonal Anti-WNT5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

HDAC1 mouse monoclonal antibody, clone 5C11, Purified

Applications ELISA, IF, IHC, PLA, WB
Reactivities Human, Mouse, Rat

HDAC1 mouse monoclonal antibody, clone 3E1, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat

HDAC1 mouse monoclonal antibody, clone 1D6, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat

HDAC1 mouse monoclonal antibody, clone 5A11, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

EGFR sheep polyclonal antibody, Purified

Applications IF, IHC, IP, WB
Reactivities Chicken, Human, Mouse, Rat
Immunogen Synthetic 20 amino acid peptide of human EGFr representing a portion of the internal domain proximal to a phosphorylation region

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).

Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Thr693, Mouse: Thr695, Rat: Thr694
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S).
Modifications Phospho-specific

Rabbit polyclonal anti-HDAC1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HDAC1.

Rabbit Polyclonal anti-GLI2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE

Rabbit Polyclonal Anti-WNT7B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM

EGFR L858R mouse monoclonal antibody,clone UMAB233

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

EGFR (Ligand binding Site) mouse monoclonal antibody, clone EGF-R1, Purified

Applications ELISA, FC, IHC
Reactivities Human

EGFR (Ligand bdg. Dom.) mouse monoclonal antibody, clone EGF-R1, Purified

Applications ELISA, FC, IHC
Reactivities Human

c Kit (KIT) mouse monoclonal antibody, clone 4F7, Purified

Applications ELISA, IHC, WB
Reactivities Human

c Kit (KIT) mouse monoclonal antibody, clone X1, Purified

Applications ELISA, IHC, WB
Reactivities Human

EGF rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Immunogen Recombinant EGF precursor from Suberites domuncula.

EGF rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Immunogen Recombinant EGF precursor from Suberites domuncula.

c Kit (KIT) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit.

EGF rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

HDAC1 (271-477) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 271 and 477 of HDAC1

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).

Rabbit polyclonal anti-WNT1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human WNT1.

Anti-HGF Mouse Monoclonal (7-2) Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal anti-EGFR antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR.

Rabbit polyclonal anti-HDAC-1 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1.

Mouse monoclonal EGFR Antibody

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated