Germany
Japan
United Kingdom
China
SPHK2 (Long Form) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from the N-terminal extension of the Sphingosine Kinase 2-L protein |
Primary Antibodies
View as table Download
DEGS1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide derived from the Human DEGS1 protein |
Rabbit polyclonal anti-GLB1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLB1. |
Rabbit polyclonal Neuraminidase antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-124 of Human Neu2. |
Rabbit Polyclonal SPT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SPT1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SPT1. The immunogen is located within amino acids 380 - 430 of SPT1. |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit polyclonal Anti-SMPD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMPD3 antibody: synthetic peptide directed towards the middle region of human SMPD3. Synthetic peptide located within the following region: RPPEADDPVPGGQARNGAGGGPRGQTPNHNQQDGDSGSLGSPSASRESLV |
Rabbit Polyclonal Anti-GALC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GALC Antibody: synthetic peptide directed towards the middle region of human GALC. Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL |
Rabbit Polyclonal Anti-SGPP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGPP2 antibody: synthetic peptide directed towards the C terminal of human SGPP2. Synthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL |
Rabbit Polyclonal Anti-CERK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CERK antibody is: synthetic peptide directed towards the C-terminal region of Human CERK. Synthetic peptide located within the following region: FVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSS |
Rabbit Polyclonal Anti-DEGS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DEGS1 antibody: synthetic peptide directed towards the N terminal of human DEGS1. Synthetic peptide located within the following region: GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV |
Rabbit Polyclonal Anti-ACER2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACER2 antibody is: synthetic peptide directed towards the middle region of Human ACER2. Synthetic peptide located within the following region: DELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVTTCLAFV |
Rabbit Polyclonal Anti-SGMS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY |
Rabbit Polyclonal Anti-SPTLC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI |
USD 360.00
5 Days
sphingosine 1 phosphate phosphatase 1 (SGPP1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from the sphingosine 1-phosphate phosphatase 1 protein. |
USD 360.00
5 Days
Sphingosine 1 phosphate phosphatase 2 (SGPP2) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from the sphingosine 1-phosphate phosphatase 2 protein. |
SPTLC1 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from the human serine palmitoyltransferase enzyme |
DEGS2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from human DEGS2 protein |
DEGS2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from Human DEGS2 protein |
NSMase2 (SMPD3) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from human sphingomyelin phosphodiesterase 3 |
NSMase2 (SMPD3) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from human sphingomyelin phosphodiesterase 3 |
DEGS1 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide derived from the Human DEGS1 protein. |
Sphingomyelin Synthase 2 (SGMS2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of Human SGMS2. |
Goat Anti-SPHK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DVDLESEKYRRLGE, from the internal region of the protein sequence according to NP_068807.2; NP_892010.1. |
Rabbit Polyclonal ASAH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human ASAH2. |
Rabbit Polyclonal Sphingosine Kinase 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to a region between residue 334-384 of human sphingosine kinase 1 using the numbering given in entry NP_001136073.1 |
Goat Anti-UGT8 Antibody
| Applications | WB |
| Reactivities | Expected from seq similarity: Human, Rat, Dog, Cow |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NGKYKRNGHIK, from the internal region of the protein sequence according to NP_003351.2. |
Rabbit polyclonal anti-ACER1 (ASAH3) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ASAH3. |
Rabbit polyclonal anti-Sphingosine Kinase 1 (SPK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acid 180 of mouse Sphingosine Kinase 1 |
Rabbit polyclonal SH3BP2 phospho S427 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 422-433 of Human SH3BP3 protein (SH3 Domain Binding Protein 2). |
| Modifications | Phospho-specific |
Rabbit polyclonal Anti-SGMS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGMS1 antibody: synthetic peptide directed towards the middle region of human SGMS1. Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI |
Rabbit Polyclonal Anti-NEU2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NEU2 antibody is: synthetic peptide directed towards the N-terminal region of Human NEU2. Synthetic peptide located within the following region: ANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLH |
Rabbit Polyclonal Anti-ENPP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the middle region of Human ENPP7. Synthetic peptide located within the following region: DLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLT |
Rabbit Polyclonal Anti-ENPP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the N-terminal region of Human ENPP7. Synthetic peptide located within the following region: WITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANI |
Rabbit Polyclonal Anti-SGPL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGPL1. Synthetic peptide located within the following region: IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT |
Rabbit Polyclonal Anti-SGMS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY |
Rabbit Polyclonal Anti-SPTLC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY |
Rabbit Polyclonal Anti-SMPD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMPD1 antibody: synthetic peptide directed towards the middle region of human SMPD1. Synthetic peptide located within the following region: INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV |
Rabbit Polyclonal Anti-SGPP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGPP1 antibody: synthetic peptide directed towards the middle region of human SGPP1. Synthetic peptide located within the following region: THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT |
Rabbit Polyclonal Anti-NEU4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEU4 antibody: synthetic peptide directed towards the N terminal of human NEU4. Synthetic peptide located within the following region: TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE |
Rabbit Polyclonal Anti-Smpd4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP |
Rabbit Polyclonal Anti-ACER1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: ITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC |
Rabbit anti SPHK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A recombinant protein encoding the full length of 618 aa human SPHK2. |
Carrier-free (BSA/glycerol-free) NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Applications
- WB
Pathways
- Sphingolipid metabolism
Filter by
Category
Target Symbol
- NEU1 (41)
- GBA (34)
- GLB1 (28)
- NEU2 (18)
- SMPD1 (11)
- SPHK1 (11)
- PLPP1 (9)
- SGMS2 (6)
- SPHK2 (6)
- SPTLC1 (6)
- ARSA (5)
- ASAH1 (5)
- CERK (4)
- DEGS1 (4)
- SGPL1 (4)
- UGT8 (4)
- ACER1 (3)
- DEGS2 (3)
- ENPP7 (3)
- PLPP2 (3)
- SGMS1 (3)
- SMPD3 (3)
- ACER2 (2)
- ASAH2 (2)
- GALC (2)
- GLA (2)
- NEU3 (2)
- NEU4 (2)
- SGPP1 (2)
- SGPP2 (2)
- SMPD2 (2)
- SPTLC2 (2)
- ACER3 (1)
- B4GALT6 (1)
- GAL3ST1 (1)
- PLPP3 (1)
- SMPD4 (1)
- UGCG (1)