Primary Antibodies

View as table Download

Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker

Applications IHC, WB
Reactivities Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus
Conjugation Unconjugated

Rabbit Polyclonal antibody to beta Actin (actin, beta)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin

Mouse monoclonal Hsp70/Hsc70 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus
Conjugation Unconjugated

Rabbit polyclonal Hsp70 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa)
Conjugation Unconjugated
Immunogen Full length human protein Hsp70

Mouse monoclonal Hsp60 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Hamster, Monkey, Pig, Rabbit, Spinach, E.coli (GroEl), H. pylori, S. typhimurium, T. spiralis, yeast, white fly
Conjugation Unconjugated

Rabbit polyclonal p38 Antibody

Applications WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig
Conjugation Unconjugated
Immunogen A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH.

TRPC5 (927-845) mouse monoclonal antibody

Applications IF, IHC, IP, WB
Reactivities Guinea Pig, Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Anti-DOPA Decarboxylase, Human Antibody

Applications WB
Reactivities Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH

Mouse Monoclonal anti-Hsc70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated

Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348)

Rabbit Polyclonal Neurokinin 1 Receptor Antibody

Applications WB
Reactivities Guinea Pig, Human, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the N-terminus of human NK-1 sequence conjugated to KLH.

Mouse monoclonal Hsp70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, C.elegans, Canine, Chicken, Drosophilia, Carp, Guinea pig, Hamster, Monkey, Pig, Rabbit, Sheep
Conjugation Unconjugated

Rabbit Polyclonal MUC-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal Antibody against VEGFA

Applications WB
Reactivities Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692]

Rabbit Polyclonal anti-CALR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated
Immunogen Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

NSE (ENO2) mouse monoclonal antibody, clone 5E2

Applications ELISA, IHC, WB
Reactivities Guinea Pig, Human
Conjugation Unconjugated

NOS1 (1419-1433) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Feline, Guinea Pig, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen C-terminal synthetic peptide sequence corresponding to amino acids (1419-1433) of human nNos coupled to KLH.

Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559)

Rabbit Polyclonal anti-CANX Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH.

Rabbit Polyclonal anti-CANX Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH.

Rabbit Polyclonal anti-UBB Antibody

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila
Conjugation Unconjugated
Immunogen Native bovine Ubiquitin, conjugated to KLH

Rabbit Polyclonal Anti-SOD (Mn) Antibody

Applications IF, WB
Reactivities Human, Rat, Mouse, Bovine, Canine, Chicken, Dosophila, Guinea Pig, Pig, Hamster, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen Rat Mn SOD

Rabbit Polyclonal HIF-1 alpha Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus
Conjugation Unconjugated
Immunogen Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665]

Neurokinin 3 Receptor NK3 (TACR3) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Guinea Pig, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal antibody to RAMP1 (receptor (G protein-coupled) activity modifying protein 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 84 and 148 of RAMP1 (Uniprot ID#O60894)

Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549)

Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 293 and 387 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1)

Rabbit Polyclonal anti-CANX Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Mouse Monoclonal anti-Hsc70 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated

Mouse monoclonal Hsp60 Antibody

Applications IHC, WB
Reactivities Bovine, Canine, Chicken, Drosophila, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig
Conjugation Unconjugated

Rabbit polyclonal Cpn10 Antibody

Applications IHC, WB
Reactivities Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig
Conjugation Unconjugated
Immunogen Human Cpn10 peptide AA 91-101

Rat Monoclonal Anti-TCP1 alpha Antibody

Applications WB
Reactivities Mouse, Rat, Rabbit, Guinea pig, Hamster, Cow, Dog, Human, Pig, Saccharomyces cerevisiae, Caenorhabditis elegans, Fruit fly (Drosophila melanogaster), Monkey
Conjugation Unconjugated

Rabbit Polyclonal Anti-FAM86A Antibody

Applications WB
Reactivities Guinea Pig, Human, Rat, Dog, Horse, Cow
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE

Rabbit anti Actin, skeletal muscle Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat, Rabbit, GP
Conjugation Unconjugated
Immunogen A synthetic peptide derived from N-terminus of human alpha skeletal muscle isoforms of actin. This sequence is identical in human, rat, mouse, dog, bovine, guinea pig, sheep and frog origins.

Goat Polyclonal Antibody against PCK2 / PEPCK-M

Applications WB
Reactivities Human, Mouse, Rat, Guinea Pig
Conjugation Unconjugated
Immunogen Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2.

Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1)

Rabbit Polyclonal anti-CANX Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Mouse Monoclonal anti-PDIA3 Antibody

Applications WB
Reactivities Human, Mouse, Bovine, Dog, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Rat
Conjugation Unconjugated

Rabbit polyclonal Glutathione Peroxidase 4 antibody

Applications WB
Reactivities Guinea Pig, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of mouse GPx4 protein.

Mouse monoclonal Erp57 (Grp58) Antibody

Applications WB
Reactivities Bovine, Canine, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Pig
Conjugation Unconjugated

Mouse monoclonal p23 Antibody

Applications WB
Reactivities Human, Mouse, Rabbit, Chicken, Guinea pig, S. cerevisiae (lower)
Conjugation Unconjugated

Mouse monoclonal GRP94 Antibody

Applications WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig, Horse
Conjugation Unconjugated

Rabbit polyclonal Akt2 (PKB beta) Antibody

Applications WB
Reactivities Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig
Conjugation Unconjugated
Immunogen A five residue synthetic peptide based on the human Akt2, coupled to KLH

Rabbit Polyclonal Anti-Calnexin -CT Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak)
Conjugation Unconjugated
Immunogen Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rat Monoclonal Anti-HSF2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Guinea Pig, Hamster, Monkey, Rabbit. Dog, Bovine, Sheep, Pig
Conjugation Unconjugated

Recombinant Anti-Syntaxin (Clone SP6)

Applications IHC, WB
Reactivities Guinea Pig, Hamster, Human, Rabbit, Rat, Dog, Pig, Cow
Conjugation Unconjugated

Recombinant Anti-Syntaxin (Clone SP6)

Applications IHC, WB
Reactivities Guinea Pig, Hamster, Human, Rabbit, Rat, Dog, Pig, Cow
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-SNAP-25 (Clone SP12)

Applications ELISA, IF, IHC, WB
Reactivities Feline, Guinea Pig, Hamster, Human, Mouse, Rat, Pig, Cow
Conjugation Unconjugated

Recombinant Anti-SNAP-25 (Clone SP12)

Applications ELISA, IF, IHC, WB
Reactivities Feline, Guinea Pig, Hamster, Human, Mouse, Rat, Pig, Cow
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.