Anti-HES1 mouse mAb, clone OTI4H1, DyLight488 conjugated
Applications | FC |
Reactivities | Human |
Conjugation | DyLight 488 |
Anti-HES1 mouse mAb, clone OTI4H1, DyLight488 conjugated
Applications | FC |
Reactivities | Human |
Conjugation | DyLight 488 |
Anti-HES1 mouse mAb, clone OTI4H1, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-HES1 mouse mAb, clone OTI4H1, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Cow |
Conjugation | Unconjugated |
DLL4 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
Rabbit Polyclonal Anti-HES5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HES5 antibody was raised against a 19 amino acid peptide near the amino terminus of human HES5. |
Rabbit Polyclonal Anti-JAG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | JAG1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human JAG1. |
Rabbit Polyclonal Anti-Beclin 2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Beclin 2 antibody was raised against a 16 amino acid peptide near the amino terminus of human Beclin 2. |
DLL3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 519-548 aa) of human DLL3. |
Rabbit Polyclonal DLL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 100 to 150 of human DLL3 was used as immunogen for the antibody. |
Rabbit polyclonal Notch 1 (Cleaved-Val1744) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Notch 1. |
Rabbit polyclonal anti-Jagged 1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-125 of human Jagged-1protein. |
Rabbit Polyclonal APH1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APH1 antibody was raised against a 18 amino acid peptide from near the center of human APH1. |
DLL4 rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure HEK293 cells derived Recombinant Human sDLL-4 (Cat.-No AR31113PU-N). |
Rabbit polyclonal anti-DELTA-4 antibody
Applications | IHC, WB |
Reactivities | Human, partial reactivity to Mouse and Rat |
Conjugation | Unconjugated |
Immunogen | Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4. |
Rabbit polyclonal DVL1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1. |
Rabbit Polyclonal Anti-Notch 1 (Cleaved-Val1744) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Notch 1 (Cleaved-Val1744) Antibody: A synthesized peptide derived from human Notch 1 (Cleaved-Val1744) |
HES1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide. Epitope: N-Terminus |
Rabbit polyclonal DVL3 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3. |
Mouse Monoclonal Notch-1 Antibody (mN1A)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat (Negative) |
Conjugation | Unconjugated |
Rabbit Polyclonal Notch-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human NOTCH1 protein (between residues 2300-2350) [UniProt P46531] |
Rabbit Polyclonal HES5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid1-50 of human HES5 was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-DLL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DLL3 antibody is: synthetic peptide directed towards the C-terminal region of Human DLL3. Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL |
Rabbit Polyclonal Anti-HES5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HES5 |
Rabbit Polyclonal Notch1 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Dishevelled 3 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
DLL4 rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure HEK293 cells derived Recombinant Human sDLL-4 (Cat.-No AR31113PU-N). |
DLL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Immunogen | Highly pure recombinant Human sDLL-4. |
DLL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Immunogen | Highly pure recombinant Human sDLL-4. |
Jagged1 (JAG1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1129-1158 amino acids from the C-terminal region of Human CD339 / JAG1 |
Goat Polyclonal Antibody against APH1A
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVTDRSDARLQYG, from the internal region of the protein sequence according to NP_001071096.1; NP_057106.2. |
Rabbit polyclonal anti-NOTCH 1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues of human Notch 1 located near the N-terminal sequence of the cleaved N intracellular domain (NICD). |
Goat Anti-JAG1 Antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TNKQDNRDLESAQS, from the C Terminus of the protein sequence according to NP_000205.1. |
Biotinylated Anti-Human sDLL-4 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | HEK293 cells derived Recombinant Human sDLL-4 |
Anti-Human sDLL-4 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | HEK293 cells derived Recombinant Human sDLL-4 |
Rabbit Polyclonal Anti-DVL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the middle region of human DVL1. Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
Rabbit Polyclonal Anti-DLL1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP |
Rabbit Polyclonal Anti-DLL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC |
purified HES1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1B5
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700482 |
purified HES1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2D2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700484 |
purified HES1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI7B9
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700483 |
purified HES1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1F11
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700484 |
NOTCH1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding to a sequence at the middle region of human NOTCH1 |
NOTCH1 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Human |
Immunogen | A synthetic peptide from C-terminal of human notch-1 |
Dishevelled 2 (DVL2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 587-617 amino acids from the C-terminal region of Human DVL2. |
Goat Anti-DLL1 Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3. |
Rabbit Polyclonal APH1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | APH1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human APH1a. |
Rabbit polyclonal anti-DVL2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2. |
Rabbit polyclonal anti-Dvl3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 583 of mouse Dvl3 |