Germany
Japan
United Kingdom
China
Rabbit anti-LIMK2 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIMK2 |
Primary Antibodies
Download
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Rabbit anti-CDK5 Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDK5 |
Rabbit anti-NRP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NRP1 |
Rabbit Polyclonal Anti-CHP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
Rabbit Polyclonal Anti-ABL1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ABL1 |
USD 440.00
2 Weeks
Goat Anti-UNC5C Antibody
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NCTVSEEPTGID, from the internal region of the protein sequence according to NP_003719.2. |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Rabbit polyclonal EPHA3 (Ab-602) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EPHA3. |
Rabbit Polyclonal NFAT4 (Ser165) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NFAT4 around the phosphorylation site of Serine 165 |
| Modifications | Phospho-specific |
Goat Anti-UNC5B (aa629-643) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SARDWIFQLKTQAHQ, from the internal region of the protein sequence according to NP_734465.2. |
Rabbit anti-EFNA1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EFNA1 |
Rabbit Polyclonal Anti-EPHA5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA5 antibody: synthetic peptide directed towards the middle region of human EPHA5. Synthetic peptide located within the following region: SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP |
Rabbit Polyclonal Anti-EPHA7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA7 Antibody: A synthesized peptide derived from human EPHA7 |
Rabbit Polyclonal Anti-SDF 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
Rabbit Polyclonal Anti-EPHA3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA3 Antibody: A synthesized peptide derived from human EPHA3 |
USD 379.00
In Stock
USD 440.00
2 Weeks
CXCR4 mouse monoclonal antibody, clone B-R24, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
Cofilin 1 (CFL1) (+ Cofilin 2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cofilin1/Cofilin2 around the phosphorylation site of Tyrosine 86~90(A-T-Y-E-T). |
Cofilin 1 (CFL1) (+ Cofilin 2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cofilin1/Cofilin2 around the phosphorylation site of Tyrosine 86~90(A-T-Y-E-T). |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
Rabbit monoclonal antibody against NFAT1 (clone EPR2973 )
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal NFAT3 (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human NFAT3 around the phosphorylation site of serine 676 (K-R-SP-P-T). |
Active filters
Category
- Antibodies
Pathways
- Axon guidance
Filter by
Target Symbol
- L1CAM (96)
- MAPK1 (74)
- LIMK1 (64)
- MET (64)
- EFNA2 (63)
- KRAS (58)
- HRAS (47)
- PTK2 (41)
- CHP1 (28)
- ITGB1 (27)
- SEMA4D (27)
- PAK1 (26)
- CFL1 (23)
- CXCR4 (23)
- MAPK3 (23)
- PAK4 (22)
- SEMA3G (22)
- ABL1 (21)
- RASA1 (21)
- DPYSL2 (20)
- GSK3B (20)
- CDK5 (18)
- NRAS (17)
- CXCL12 (16)
- DCC (15)
- EPHA1 (15)
- EPHA2 (15)
- ROCK2 (15)
- PPP3CA (14)
- NFATC1 (13)
- EFNB2 (12)
- FYN (12)
- LIMK2 (11)
- RND1 (11)
- GNAI1 (10)
- NFATC4 (10)
- SEMA3D (10)
- EFNA3 (9)
- EPHB1 (9)
- PPP3CB (9)
- RHOA (9)
- EPHA6 (8)
- PAK2 (8)
- RHOD (8)
- EFNA5 (7)
- EFNB1 (7)
- EPHA3 (7)
- FES (7)
- NCK2 (7)
- NFATC2 (7)
- NRP1 (7)
- PAK5 (7)
- ROCK1 (7)
- EFNA1 (6)
- EFNB3 (6)
- EPHA7 (6)
- EPHB2 (6)
- EPHB6 (6)
- NFATC3 (6)
- RAC1 (6)
- CDC42 (5)
- EPHA4 (5)
- PAK3 (5)
- UNC5C (5)
- CFL2 (4)
- EPHB4 (4)
- GNAI2 (4)
- NCK1 (4)
- NTN1 (4)
- RGS3 (4)
- SEMA4A (4)
- SEMA4B (4)
- EFNA4 (3)
- EPHA5 (3)
- GNAI3 (3)
- NFAT5 (3)
- PAK6 (3)
- PPP3CC (3)
- ROBO1 (3)
- ROBO2 (3)
- SEMA4F (3)
- SEMA6A (3)
- SEMA6D (3)
- SEMA7A (3)
- SLIT2 (3)
- ABLIM1 (2)
- ARHGEF12 (2)
- DPYSL5 (2)
- EPHA8 (2)
- EPHB3 (2)
- PLXNA2 (2)
- PLXNB1 (2)
- RAC2 (2)
- ROBO3 (2)
- SEMA3B (2)
- SEMA3E (2)
- SEMA4C (2)
- SEMA5A (2)
- SLIT1 (2)
- SLIT3 (2)
Reactivities
- Human (1133)
- Mouse (997)
- Rat (887)
- Dog (104)
- Monkey (89)
- Bovine (25)
- Chicken (20)
- Pig (15)
- Cow (10)
- Canis (8)
- Xenopus (5)
- Rabbit (4)
- Canine (3)
- Rhesus Monkey (3)
- X. tropicalis (3)
- Drosophila (2)
- Hamster (2)
- Primate (2)
- Bat (1)
- C. elegans (1)
- Chimpanzee (1)
- Gorilla (1)
- Horse (1)
- Orang-Utan (1)
- Sheep (1)
- Zebrafish (1)