Primary Antibodies

View as table Download

lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700017

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified

Applications FC, IHC
Reactivities Human

Rabbit Polyclonal Anti-IFNG Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IFNG

TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700026

CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700027

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.

C1QA goat polyclonal antibody, FITC

Applications ELISA, ID, IF, IHC, IP
Reactivities Human
Conjugation FITC
Immunogen The subunit C1q is isolated as a homogenous protein for use in antiserum production.
Freund’s complete adjuvant is used in the first step of the immunization.

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

IL10 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

Rabbit polyclonal anti-CD40 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human CD40.

Rabbit Polyclonal Anti-C1QA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG

CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified

Applications FC, IHC, IP
Reactivities Human

Complement C3 (C3) rabbit polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen C3b (C3c+C3d) has a molecular weight of 170,000. The protein is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

IL10 mouse monoclonal antibody, clone B-S10, Azide Free

Applications ELISA, FN
Reactivities Human

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L

C1QA rabbit polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen The subunit C1q is isolated as a homogenous protein for use in antiserum production.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit polyclonal C1QC Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC.

Rabbit polyclonal C1QB Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This C1QB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 55-81 amino acids from the N-terminal region of human C1QB.

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ

Rabbit Polyclonal Anti-C8G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C8G antibody is: synthetic peptide directed towards the N-terminal region of Human C8G. Synthetic peptide located within the following region: VGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGD

USD 320.00

In Stock

Goat Polyclonal Anti-IL10 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human IL10 produced in E. coli.

CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified

Applications FC, IHC, IP, WB
Reactivities Human

CD40 mouse monoclonal antibody, clone B-B20, Azide Free

Applications FC, FN, IHC
Reactivities Human

CD40 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40

C2 rabbit polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen The C2 component of human complement is a single-chain polypeptide with a molecular weight of 110,000. It is present in plasma in an average concentration of 25 μg/ml. The activated form of C2 combines with the activated C4 to form a complex with C3-convertase activity in the classical pathway of complement activation. C2 is isolated as a homogenous protein for use in the antiserum production.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

C3 rabbit polyclonal antibody, Serum

Applications ID, IHC, IP
Reactivities Human
Immunogen C3c is the major fragment resulting from the C3 cleavage by C3 convertase and factor i. It is composed of an intact beta chain bound to two fragments of the alpha chain. The protein is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Complement C7 (C7) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 375-403 amino acids from the Center region of human C7

IL10 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

Mouse Anti-Human CD40 Purified (100 ug)

Reactivities Human
Conjugation Unconjugated

Anti-Human IL-10 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-10

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV

Rabbit Polyclonal Anti-Interferon gamma Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma
TNF

USD 320.00

In Stock

Goat Polyclonal Anti-TNF alpha Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human TNF-_ produced in E. coli.
TNF

USD 470.00

In Stock

Mouse Monoclonal Anti-TNF Antibody, Biotinylated

Applications E
Reactivities Human, Monkey
Conjugation Biotin

Complement C7 (C7) mouse monoclonal antibody, clone 030-113.7.5.4, Purified

Applications ELISA, FN, WB
Reactivities Human

Interferon gamma (IFNG) mouse monoclonal antibody, clone 315, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified

Applications ELISA, FN, WB
Reactivities Human

IL10 mouse monoclonal antibody, clone BN-10, FITC

Applications FC, IHC
Reactivities Human
Conjugation FITC

Interferon gamma (IFNG) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 31-80 of Human IFN-γ.

Complement C4A (C4A) rabbit polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen C4 and C2 represent substrates for activated C1. Both components are present in serum in an inert form. C4 is composed of 3 polypeptide chains of three different types, , , . One of the chains is cleaved by the action of activated C1, resulting in activation of C4 exposing an binding site for the next component in the sequence, C2. C4 has a molecular weight of 205.000 and is present in plasma in an average concentration of 600 μg/ml. The activation of C4 yields two peptide fragments: C4a (MW 8,000) and C4b (MW 198,000). This process shows a considerable degree of similarity to the activation of the components C3 and C5. The C4 is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure.

C3 rabbit polyclonal antibody, Serum

Applications ID, IP, R
Reactivities Guinea Pig
Immunogen The protein is isolated and purified from pooled normal Guinea Pig serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal antibody to Complement C2 (complement component 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 265 and 642 of Complement C2 (Uniprot ID#P06681)