Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3C2-4
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3G11-14
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 4A5-19
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5F4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5G12-21
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6F5-23
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6H8-22
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8E8-2
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8F6-6
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 9G5-20
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 12G4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 15C4-8
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 16F12-11
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Active filters
Reactivities
- Rat
Pathways
- Focal adhesion
Filter by
Target Symbol
- MAP2K1 (224)
- ERBB2 (214)
- JUN (176)
- CTNNB1 (144)
- EGFR (139)
- AKT1 (109)
- BRAF (90)
- BCL2 (72)
- PARVA (70)
- MAPK1 (69)
- PIK3CG (60)
- PDGFRA (55)
- MET (45)
- PIK3R5 (45)
- HRAS (44)
- CCND2 (40)
- AKT2 (38)
- MAPK8 (37)
- PXN (37)
- PDGFRB (36)
- VASP (35)
- PIK3CD (31)
- PARVB (30)
- BCAR1 (28)
- HGF (28)
- CCND1 (27)
- KDR (27)
- MAPK9 (27)
- PTK2 (27)
- SHC1 (27)
- MYL7 (26)
- ACTB (25)
- IGF1R (25)
- RAPGEF1 (23)
- PIK3CA (22)
- FLT4 (21)
- PRKCA (21)
- VEGFB (21)
- IGF1 (20)
- FN1 (19)
- MAPK10 (19)
- PAK4 (18)
- SRC (18)
- AKT3 (16)
- ITGB3 (16)
- RAF1 (16)
- ITGB1 (15)
- MAPK3 (15)
- GSK3B (14)
- PAK1 (13)
- BAD (12)
- CAPN2 (12)
- CAV1 (12)
- PTEN (11)
- ROCK2 (11)
- VCL (11)
- ACTN1 (10)
- LAMA4 (10)
- COL3A1 (9)
- ELK1 (9)
- ILK (9)
- PIK3R1 (9)
- SPP1 (9)
- PRKCB (8)
- MYL9 (7)
- PAK2 (7)
- PPP1CA (7)
- RHOA (7)
- VEGFA (7)
- CCND3 (6)
- ITGB6 (6)
- LAMB2 (6)
- PPP1CB (6)
- VAV1 (6)
- VEGFC (6)
- ARHGAP5 (5)
- COL5A2 (5)
- COL6A1 (5)
- FLNA (5)
- FLT1 (5)
- FYN (5)
- GRB2 (5)
- ITGB4 (5)
- PDGFB (5)
- PDGFD (5)
- PDPK1 (5)
- RAC1 (5)
- ROCK1 (5)
- XIAP (5)
- CDC42 (4)
- COL2A1 (4)
- PAK3 (4)
- ACTG1 (3)
- ACTN3 (3)
- BIRC2 (3)
- CRK (3)
- EGF (3)
- ITGA4 (3)
- ITGAV (3)
- ITGB5 (3)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2664)
- Protein Kinase (1402)
- ES Cell Differentiation/IPS (1141)
- Transmembrane (732)
- Transcription Factors (338)
- Secreted Protein (267)
- Stem cell - Pluripotency (189)
- Stem cell relevant signaling - JAK/STAT signaling pathway (184)
- Adult stem cells (172)
- Cancer stem cells (139)
- Protease (40)
- Stem cell relevant signaling - DSL/Notch pathway (27)
- Stem cell relevant signaling - Wnt Signaling pathway (27)
- Phosphatase (26)
- Embryonic stem cells (5)
- Induced pluripotent stem cells (5)