Antibodies

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit Polyclonal Anti-DAF Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DAF antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DAF. The immunogen is located within amino acids 360 - 410 of DAF.

Rabbit Polyclonal Antibody against CD19 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19.

MCSF Receptor (CSF1R) (531-580) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 531-580 of Human c-Fms

Rabbit Polyclonal CD4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Rabbit
Conjugation Unconjugated
Immunogen A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730]

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.

FLT3 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Immunogen Peptide sequence around amino acids 589~593 (Y-F-Y-V-D) drerived from Human FLT3.

Rabbit Polyclonal Antibody against CD36

Applications IHC, WB
Reactivities Human, Bovine, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide mapping to a region of human CD36 between residues 100-200.

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

GM CSF (CSF2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 59-85 amino acids from the Central region of Human CSF2

Rabbit polyclonal CSFR (Ab-809) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V).

Rabbit Polyclonal Integrin alpha M/CD11b Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555]

Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T).
Modifications Phospho-specific

MCSF Receptor (CSF1R) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 771-820 of Human c-Fms.

CD4 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide corresponding to amino acids 391-440 of Human CD4.

Rabbit Polyclonal Antibody against CD9 (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-145 amino acids from the Central region of human CD9.

Rabbit Polyclonal SCF Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SCF antibody was raised against an 18 amino acid peptide from near the center of human SCF.

Rabbit polyclonal CD38 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38.

USD 370.00

Please Inquire

IL4R rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 460-510 of Human IL-4Rα.

Integrin alpha 4 (ITGA4) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to the C-terminal of human ITGA4

CD1E (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 274-304 amino acids from the Central region of human CD1E

Rabbit Polyclonal Antibody against CD14 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14.

Rabbit polyclonal IL-7R/CD127 (Tyr449) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-7R/CD127 around the phosphorylation site of tyrosine 449 (E-A-YP-V-T).
Modifications Phospho-specific

Rabbit polyclonal CSF1R Antibody

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CSF1R antibody is generated from rabbits immunized with CSF1R recombinant protein.

Integrin alpha 6 (ITGA6) (1043-1072) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from isoform 2 of human ITGA6.

Integrin alpha 4 (ITGA4) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide (GNSAGPKSMEVSC) from (C-term) of human NDRG1

Rabbit Polyclonal Antibody against KITLG (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SCF (KITLG) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human SCF (KITLG).

Rabbit Polyclonal antibody to CD55 (CD55 molecule, decay accelerating factor for complement (Cromer blood group))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 71 and 330 of CD55 (Uniprot ID#P08174)

Rabbit Polyclonal antibody to IL1 receptor 2 (interleukin 1 receptor, type II)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 172 and 398 of IL1 Receptor 2 (Uniprot ID#P27930)

Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44

Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6.

Rabbit polyclonal MME Antibody (Center)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME.

Rabbit Polyclonal CD11b/c Antibody

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region (within residues 500-600) of the mouse CD11 (b/c) protein. [Swiss-Prot# P05555]

Rabbit Polyclonal EPO Receptor Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human EPO receptor protein (between residues 300-400) [UniProt P19235]

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF

FLT3 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Immunogen Peptide sequence around amino acids 589~593 (Y-F-Y-V-D) drerived from Human FLT3.

EPOR rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

IL2 Receptor alpha (IL2RA) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

c Kit (KIT) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 16 amino acid peptide from near the center of human Integrin alpha 4.

Rabbit polyclonal IL-2Ra/CD25 (Ser268) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-2Ra/CD25 around the phosphorylation site of serine 268 (R-K-SP-R-R).
Modifications Phospho-specific

Rabbit Polyclonal FLT3 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen FLT3 antibody was raised against an 18 amino acid synthetic peptide near the center of human FLT3.

Rabbit Polyclonal Anti-CSF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP

Rabbit Polyclonal Anti-CSF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG

Rabbit Polyclonal TNF-alpha Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

Rabbit Polyclonal Anti-IL-11 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-11 antibody was raised against a 16 amino acid peptide from near the amino terminus of human IL-11. The immunogen is located within amino acids 40 - 90 of IL-11.

Rabbit polyclonal antibody to HLA-DRB3 (major histocompatibility complex, class II, DR beta 3)

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 4 and 266 of HLA-DRB3 (Uniprot ID#P79483)

Rabbit anti-FLT3 polyclonal antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized non-phosphopeptide derived fromhuman FLT3 around the phosphorylation site of tyrosine 591 (Y-F-YP-V-D).