Antibodies

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

VIP rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian
Conjugation Unconjugated
Immunogen Porcine VIP coupled to bovine thyroglobulin (BTg) with carbodiimide (CDI) linker.

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Antibody against LC3B

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of the human LC3, isoform B protein.

Rabbit Polyclonal Antibody against GFAP (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP.

ABCC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4

Rabbit Polyclonal Anti-GPA33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GPA33

Rabbit Polyclonal Anti-NOX4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4.

Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591)

Rabbit Polyclonal PD-L1 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1.

Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L).
Modifications Phospho-specific

Rabbit Polyclonal VLK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK.

DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3

Rabbit anti-Nono Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A specific peptide of human Nono

Rabbit Polyclonal Dact2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Dact2 antibody was raised against a 12 amino acid peptide from near the amino terminus of human DACT2.

DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3

Rabbit Polyclonal Anti-LILRB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LILRB2

Rabbit anti-BRCA1 polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).

Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3

Rabbit Polyclonal Anti-BDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).

Rabbit Polyclonal Anti-NGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NGF

Rabbit Polyclonal Lipase A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571]

Rabbit anti-REG3A Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human REG3A

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Rabbit Polyclonal OCLN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN.

Rabbit anti-IRF3 Polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IRF3

Calca rabbit polyclonal antibody

Applications IF, IHC
Reactivities Human, Mammalian, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde.

Rabbit anti-ZEB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ZEB1

Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG

Rabbit Polyclonal Anti-TET1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1.

Rabbit Polyclonal IRAK-M Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M.

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5

Rabbit anti-HDGF Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HDGF

YB-1/YBX1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2).
Modifications Unmodified

YB-1/YBX1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2).
Modifications Unmodified

Rabbit Polyclonal Antibody against LC3

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 50-150).

Rabbit Polyclonal Nephrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin.

GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%).

MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3

TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3

Rabbit anti-ATP1B1 Polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ATP1B1

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Rabbit Polyclonal Anti-PNPLA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS

Rabbit Polyclonal RHBDD2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2.

Rabbit Polyclonal Ogg1 Antibody

Applications IHC, WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the human Ogg1 (within amino acids 1-100).

Rabbit Polyclonal TET1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TET1 protein (between residues 1700 to 1800) [UniProt Q8NFU7]

Rabbit Polyclonal FOXP3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3.