Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal CDK5 (Ab-15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDK5 around the phosphorylation site of tyrosine 15 (G-T-YP-G-T) |
Rabbit Polyclonal Anti-LRP1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR |
Rabbit Polyclonal Anti-ATP2A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Cytochrome C (CYCS) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Cytochrome C |
Rabbit anti-BAD (Phospho-Ser136) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from mouse BAD around the phosphorylation site of serine136 (S-R-S[P]-A-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal PEK/PERK (Thr981) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PEK/PERK around the phosphorylation site of threonine 981 (R-H-TP-G-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit polyclonal Amyloid β A4 (Phospho-Thr743/668) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Amyloid β A4 around the phosphorylation site of threonine 743 (A-V-TP-P-E) |
| Modifications | Phospho-specific |
APP Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | N term -peptide of human APP |
Rabbit anti-MME Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MME |
NMDAR1 (GRIN1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human NMDAR1 |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Pathways
- Alzheimer's disease
Filter by
Category
Target Symbol
- BAD (17)
- CASP3 (14)
- CASP9 (14)
- APP (12)
- CASP7 (11)
- GRIN1 (10)
- APAF1 (9)
- GSK3B (8)
- TNF (7)
- CDK5 (6)
- MME (6)
- TNFRSF1A (6)
- CASP8 (5)
- HSD17B10 (5)
- MAPT (5)
- NOS2 (5)
- BACE1 (4)
- BACE2 (4)
- CYCS (4)
- EIF2AK3 (4)
- FADD (4)
- GRIN2A (4)
- MAPK1 (4)
- PLCB3 (4)
- SNCA (4)
- APOE (3)
- BID (3)
- CACNA1C (3)
- FAS (3)
- IL1B (3)
- MAPK3 (3)
- NCSTN (3)
- NDUFS4 (3)
- NOS3 (3)
- PPP3CA (3)
- PSEN1 (3)
- SDHA (3)
- ADAM10 (2)
- ATP2A1 (2)
- ATP5F1A (2)
- CAPN1 (2)
- GRIN2B (2)
- GRIN2C (2)
- GRIN2D (2)
- NDUFV2 (2)
- PPP3CC (2)
- PSENEN (2)
- SDHB (2)
- ADAM17 (1)
- APH1A (1)
- ATP2A2 (1)
- ATP2A3 (1)
- ATP5F1B (1)
- CACNA1D (1)
- CACNA1S (1)
- CALM1 (1)
- CALM2 (1)
- CDK5R1 (1)
- COX7A2L (1)
- IDE (1)
- ITPR1 (1)
- ITPR2 (1)
- ITPR3 (1)
- LCMT2 (1)
- LRP1 (1)
- NDUFV1 (1)
- NOS1 (1)
- PLCB1 (1)
- PLCB2 (1)
- PPP3CB (1)
- PSEN2 (1)
- RYR3 (1)
- UQCRC1 (1)
- UQCRC2 (1)