Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233) |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit anti-CD74 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD74 |
Rabbit polyclonal HSP90B (Ab-254) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Rat |
| Immunogen | This CALR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the Central region of Human CALR. |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
HSP90AA1 rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Immunogen | Recombinant human Hsp90 R protein |
Rabbit Polyclonal Antibody against CD8A (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal CREB (Ser133) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of serine 133 (R-P-SP-Y-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal HSP90AB1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 697-724 amino acids from the C-terminal region of human HSP90AB1. |
Rabbit polyclonal HSP90AB1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 438-465 amino acids from the Central region of human HSP90AB1. |
Rabbit Polyclonal Anti-TAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
GRP78 (HSPA5) (550-600) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding amino acids 550-600 of human HSPA5. |
CREB1 pSer129 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Pathways
- Antigen processing and presentation