Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Rabbit Polyclonal Anti-MYH9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit polyclonal anti-Vinculin antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VCL |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit anti-CHRM5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM5 |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the C terminal of human ACTN4. Synthetic peptide located within the following region: DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI |
Rabbit Polyclonal Anti-CHRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHRM1 |
Rabbit Polyclonal antibody to ARPC2 (actin related protein 2/3 complex, subunit 2, 34kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 14 and 300 of ARPC2 (Uniprot ID#O15144) |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-LIMK2 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIMK2 |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal Anti-IQGAP3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IQGAP3 |
Rabbit Polyclonal Anti-MYLK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYLK2 |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal B-RAF (Phospho-Ser446) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
| Modifications | Phospho-specific |
Rabbit polyclonal Ezrin (Phospho-Tyr478) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Ezrin around the phosphorylation site of tyrosine 478 (P-V-YP-E-P) |
| Modifications | Phospho-specific |
WAS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human WAS |
ARHGEF7 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ARHGEF7 |
Rabbit Polyclonal Anti-PIP5K1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIP5K1B antibody is: synthetic peptide directed towards the C-terminal region of Human PIP5K1B. Synthetic peptide located within the following region: VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ |
Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
Rabbit Polyclonal Anti-MYL9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYL9 antibody: synthetic peptide directed towards the middle region of human MYL9. Synthetic peptide located within the following region: FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF |
Rabbit Polyclonal Anti-Fibronectin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fibronectin 1 Antibody: A synthesized peptide derived from human Fibronectin 1 |
Rabbit Polyclonal Anti-PI3 kinase P110a Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI3 kinase P110a Antibody: A synthesized peptide derived from human PI3 kinase P110a |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Pathways
- Regulation of actin cytoskeleton
Filter by
Target Symbol
- EGFR (36)
- EZR (18)
- PXN (14)
- RAF1 (14)
- ROCK2 (13)
- BRAF (12)
- MAPK1 (12)
- ACTB (11)
- MAP2K1 (11)
- PAK1 (11)
- PDGFRB (11)
- PTK2 (11)
- SHC1 (10)
- VCL (10)
- FGFR1 (9)
- ITGB3 (9)
- LIMK2 (9)
- MAPK3 (9)
- NCF1 (9)
- BCAR1 (7)
- CFL1 (7)
- FGF4 (7)
- LIMK1 (7)
- PDGFB (7)
- RHOA (7)
- F2R (6)
- FGF2 (6)
- ITGA4 (6)
- ITGAV (6)
- MAP2K2 (6)
- NRAS (6)
- PAK2 (6)
- PDGFRA (6)
- PIK3R1 (6)
- VAV1 (6)
- ACTN2 (5)
- ACTN4 (5)
- APC (5)
- F2 (5)
- ITGB1 (5)
- ITGB4 (5)
- MSN (5)
- PAK4 (5)
- PAK5 (5)
- PFN1 (5)
- PPP1CB (5)
- ACTG1 (4)
- ACTN1 (4)
- ACTN3 (4)
- CDC42 (4)
- CHRM1 (4)
- CSK (4)
- EGF (4)
- GNA13 (4)
- ITGA6 (4)
- ITGB2 (4)
- PAK3 (4)
- PDGFC (4)
- PIK3R3 (4)
- PPP1CA (4)
- PPP1R12A (4)
- RAC1 (4)
- RDX (4)
- RRAS2 (4)
- ARAF (3)
- ARHGEF7 (3)
- ARPC1A (3)
- ARPC2 (3)
- ARPC3 (3)
- BDKRB2 (3)
- CFL2 (3)
- CHRM5 (3)
- FGF1 (3)
- FGF13 (3)
- FGF18 (3)
- FGFR2 (3)
- FGFR3 (3)
- FGFR4 (3)
- HRAS (3)
- ITGA2B (3)
- ITGA5 (3)
- ITGB5 (3)
- MOS (3)
- MYL9 (3)
- PIK3CB (3)
- PIP4K2A (3)
- PPP1CC (3)
- ROCK1 (3)
- SLC9A1 (3)
- SOS2 (3)
- WAS (3)
- APC2 (2)
- ARHGEF1 (2)
- ARHGEF12 (2)
- ARPC1B (2)
- BAIAP2 (2)
- BDKRB1 (2)
- BRK1 (2)
- CHRM2 (2)
- CRK (2)
Reactivities
Conjugates
Modifications
Families
- Druggable Genome (581)
- Protein Kinase (223)
- Transmembrane (159)
- ES Cell Differentiation/IPS (143)
- Secreted Protein (90)
- Adult stem cells (56)
- Cancer stem cells (36)
- Stem cell - Pluripotency (36)
- Stem cell relevant signaling - JAK/STAT signaling pathway (36)
- Embryonic stem cells (20)
- GPCR (20)
- Induced pluripotent stem cells (15)
- Phosphatase (14)
- Transcription Factors (10)
- Stem cell relevant signaling - Wnt Signaling pathway (7)
- Protease (5)