Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Integrin alpha 3 (ITGA3) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 500-550 of Human Integrin α3 |
Rabbit Polyclonal Antibody against CD9 (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-145 amino acids from the Central region of human CD9. |
Rabbit Polyclonal Antibody against CD14 (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14. |
Rabbit polyclonal anti-G-CSF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 195 of human G-CSF |
Rabbit polyclonal anti-GM-CSF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human GM-CSF protein. |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit anti-IL-6R Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL-6R |
Rabbit anti-IL1R2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1R2 |
Rabbit anti-CD19 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD19 |
Rabbit anti-MME Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MME |
Rabbit anti-CD22 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD22 |
Rabbit anti-CD36 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD36 |
Rabbit Polyclonal Anti-EPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPO antibody: synthetic peptide directed towards the middle region of human EPO. Synthetic peptide located within the following region: KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
Rabbit Polyclonal Anti-Interleukin 1β Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β |
Rabbit Polyclonal Anti-Interleukin 4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4 |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
IL4R rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 460-510 of Human IL-4Rα. |
Glycophorin A (GYPA) (N-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
| Immunogen | Human Glycophorin A transmembrane protein |
IL4 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hSCF (anti-hSCF). |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hSCF. |
IL1 beta (IL1B) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Chicken |
| Immunogen | Recombinaint Chicken IL-1B |
Rabbit Polyclonal Antibody against CD9 (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of human CD9. |
Rabbit Polyclonal Antibody against CD14 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14. |
Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229) |
Rabbit polyclonal CD44 (Ser706) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD44 around the phosphorylation site of serine 706 (S-K-SP-Q-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal CSFR (Tyr561) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 561 (N-S-YP-T-F). |
| Modifications | Phospho-specific |
Rabbit polyclonal IL-7R/CD127 (Tyr449) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-7R/CD127 around the phosphorylation site of tyrosine 449 (E-A-YP-V-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-GM-CSF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed human GM-CSF |
Rabbit polyclonal anti-IL-3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-3 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-3 protein. |
Anti-THPO Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 22-349 amino acids of human Thrombopoietin |
Rabbit polyclonal CD71 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD71 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 649-677 amino acids from the C-terminal region of human CD71. |
Rabbit Polyclonal CD19 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 |
Rabbit Polyclonal CD19 (Tyr531) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 around the phosphorylation site of Tyrosine 531 |
| Modifications | Phospho-specific |
Rabbit anti-IL1B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1B |
HLA-DRB3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRB3 |
IL7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Antibody Hosts
- Rabbit
Pathways
- Hematopoietic cell lineage
Filter by
Target Symbol
- CSF1R (19)
- IL4 (13)
- KIT (13)
- EPOR (12)
- ITGB3 (11)
- KITLG (11)
- IL1B (10)
- IL7 (10)
- CD19 (8)
- FLT3 (8)
- ITGA4 (8)
- MME (7)
- CD44 (6)
- CD55 (6)
- CD9 (6)
- IL11RA (6)
- BMP2 (5)
- CD22 (5)
- CD36 (5)
- CSF1 (5)
- CSF2RA (5)
- EPO (5)
- FLT3LG (5)
- IL4R (5)
- ITGA5 (5)
- ITGA6 (5)
- TFRC (5)
- ANPEP (4)
- CD1D (4)
- CD8A (4)
- CD8B (4)
- CSF2 (4)
- DNTT (4)
- IL1R2 (4)
- IL3 (4)
- IL5 (4)
- IL6 (4)
- THPO (4)
- CD1E (3)
- CD33 (3)
- CD34 (3)
- CD3E (3)
- CD4 (3)
- CD59 (3)
- GP1BA (3)
- GYPA (3)
- HLA-DRA (3)
- IL11 (3)
- IL1A (3)
- IL2RA (3)
- IL3RA (3)
- IL7R (3)
- ITGA2 (3)
- ITGA2B (3)
- ITGAM (3)
- TNF (3)
- CD14 (2)
- CD1A (2)
- CD1B (2)
- CD37 (2)
- CD38 (2)
- CD3D (2)
- CSF3 (2)
- FCGR1A (2)
- GP1BB (2)
- GP9 (2)
- HLA-DRB3 (2)
- IL1R1 (2)
- IL5RA (2)
- IL6R (2)
- CD5 (1)
- CR2 (1)
- CSF3R (1)
- FCER2 (1)
- GP5 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- HLA-DRB5 (1)
- IL9R (1)
- ITGA1 (1)
- ITGA3 (1)
- MS4A1 (1)
- TPO (1)
Reactivities
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (325)
- Transmembrane (267)
- ES Cell Differentiation/IPS (130)
- Secreted Protein (122)
- Adult stem cells (42)
- Protein Kinase (40)
- Embryonic stem cells (35)
- Cancer stem cells (16)
- Protease (16)
- Stem cell - Pluripotency (13)
- Induced pluripotent stem cells (10)
- Stem cell relevant signaling - DSL/Notch pathway (6)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (5)
- Transcription Factors (3)