Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
Rabbit Polyclonal IRAK-M Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
Applications | Dot, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MAPK7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAPK7 |
Rabbit Polyclonal Anti-IRAK3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRAK3 |
Rabbit Polyclonal Anti-BDNF Antibody
Applications | IHC, WB |
Reactivities | Human, Macaque, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal IRS-1 (Ab-312) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
Modifications | Phospho-specific |
Rabbit anti-CAMK4 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CAMK4 |
Rabbit Polyclonal Anti-GRB2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-IRAK4 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRAK4 |
Rabbit Polyclonal Anti-IRS1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRS1 |
Anti-RHOA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit anti-YWHAB Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human YWHAB |
Rabbit Polyclonal Anti-RAF1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RAF1 |
Rabbit polyclonal RIPK2 (Ser176) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
Modifications | Phospho-specific |
NFKBIA Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NFKBIA |
MAPK7 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAPK7 |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
Modifications | Phospho-specific |
Rabbit anti-BDNF Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BDNF |
Rabbit Polyclonal ASK1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ASK1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human ASK1. |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
Modifications | Phospho-specific |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
Modifications | Phospho-specific |
Bax Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Bax |
PLCG2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLCG2 |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
Modifications | Phospho-specific |
BCL2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human BCL2 |
Rabbit Polyclonal Anti-JUN Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human JUN |
Rabbit Polyclonal Anti-MAP2K1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAP2K1 |
Rabbit Polyclonal ASK1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ASK1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ASK1. |
Rabbit Polyclonal Presenilin1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1. |
Rabbit Polyclonal IRS-1 (Ser307) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IRS-1 around the phosphorylation site of Serine 307 |
Modifications | Phospho-specific |
Rabbit Polyclonal Trk B (Tyr515) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Trk B around the phosphorylation site of Tyrosine 515 (peptide seq 509-521aa: VIENPQY(p)FGITN) |
Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
Modifications | Phospho-specific |
Rabbit anti-MEK1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human MEK1 |
MAGED1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAGED1 |
Rabbit anti-ARHGDIA Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ARHGDIA |
MAP2K7 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAP2K7 |
Rabbit anti-RIPK2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RIPK2 |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
Modifications | Phospho-specific |
Rabbit polyclonal FRS2 (Tyr436) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FRS2 around the phosphorylation site of tyrosine 436 (L-N-YP-I-Q). |
Modifications | Phospho-specific |
Rabbit Polyclonal FRS2 (Tyr436) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human FRS2 around the phosphorylation site of Tyrosine 436. |
Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit Polyclonal Akt1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1. |