Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit Polyclonal GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3. |
Rabbit polyclonal APOE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human APOE. |
Rabbit Polyclonal Anti-DKK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal KLF4 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 394-421 amino acids from the C-terminal region of human KLF4. |
Rabbit polyclonal NeuroD1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Active filters
Filter by
Target Symbol
- EGFR (79)
- HDAC1 (18)
- SOX2 (18)
- KIT (17)
- CD44 (15)
- EGF (15)
- ERBB3 (14)
- GATA1 (14)
- FGF4 (13)
- NOTCH1 (12)
- POU5F1 (11)
- SOX9 (11)
- BDNF (10)
- IGFBP1 (10)
- KLF4 (9)
- SOX1 (9)
- WNT1 (9)
- CDX2 (8)
- DKK1 (8)
- GATA3 (8)
- HNF1A (8)
- APOE (7)
- MAP2 (7)
- NEUROD1 (7)
- PAX7 (7)
- BMP2 (6)
- BMP7 (6)
- CD8A (6)
- CD9 (6)
- FGF7 (6)
- WNT3A (6)
- WNT6 (6)
- ADGRE5 (5)
- BMP5 (5)
- BMP6 (5)
- CD4 (5)
- HGF (5)
- LEF1 (5)
- PAX3 (5)
- PAX6 (5)
- PDGFC (5)
- SFRP1 (5)
- WNT2 (5)
- ZFP42 (5)
- BMP15 (4)
- CD14 (4)
- CD34 (4)
- DKK2 (4)
- IGFBP2 (4)
- LIF (4)
- BMP4 (3)
- BMP8B (3)
- CCN4 (3)
- DKK4 (3)
- FGF10 (3)
- GDF3 (3)
- GDF9 (3)
- GLI1 (3)
- GLI2 (3)
- GLI3 (3)
- SFRP5 (3)
- SMURF2 (3)
- TAL1 (3)
- WNT5A (3)
- CD72 (2)
- FGF19 (2)
- GATA2 (2)
- GDF5 (2)
- GDF7 (2)
- HES1 (2)
- SOX10 (2)
- DLL1 (1)
- FGF21 (1)
- SFRP4 (1)
- WNT7B (1)
Reactivities
- Human (410)
- Mouse (244)
- Rat (178)
- Bovine (11)
- Chicken (7)
- Monkey (6)
- Primate (5)
- Dog (4)
- Rabbit (4)
- Pig (3)
- Xenopus (3)
- Bat (2)
- Chimpanzee (2)
- Feline (2)
- Hamster (2)
- Horse (2)
- Macaque (2)
- Sheep (2)
- Canine (1)
- Canis (1)
- Cow (1)
- Fish (1)
- Gibbon (1)
- Goat (1)
- Gorilla (1)
- Guinea Pig (1)
- Opossum (1)
- Porcine (1)
- Quail (1)
- X. tropicalis (1)
- Zebrafish (1)
Applications
Clonalities
Conjugates
Modifications
Pathways
- Pathways in cancer (212)
- Cytokine-cytokine receptor interaction (139)
- Endocytosis (134)
- MAPK signaling pathway (133)
- Melanoma (129)
- Regulation of actin cytoskeleton (128)
- ErbB signaling pathway (108)
- Focal adhesion (104)
- Prostate cancer (104)
- Endometrial cancer (99)
- Gap junction (99)
- Bladder cancer (94)
- Glioma (94)
- Non-small cell lung cancer (94)
- Pancreatic cancer (94)
- Calcium signaling pathway (93)
- Dorso-ventral axis formation (91)
- Adherens junction (84)
- Colorectal cancer (84)
- Epithelial cell signaling in Helicobacter pylori infection (79)
- GnRH signaling pathway (79)
- Hedgehog signaling pathway (67)
- Hematopoietic cell lineage (63)
- Wnt signaling pathway (59)
- Melanogenesis (58)
- Basal cell carcinoma (53)
- TGF-beta signaling pathway (35)
- Notch signaling pathway (33)
- Acute myeloid leukemia (28)
- Huntington's disease (28)
- Maturity onset diabetes of the young (22)
- Cell adhesion molecules (CAMs) (18)
- Cell cycle (18)
- Chronic myeloid leukemia (18)
- ECM-receptor interaction (15)
- Antigen processing and presentation (14)
- Prion diseases (12)
- Primary immunodeficiency (11)
- T cell receptor signaling pathway (11)
- Neurotrophin signaling pathway (10)
- Alzheimer's disease (7)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (5)
- Renal cell carcinoma (5)
- Thyroid cancer (5)
- Jak-STAT signaling pathway (4)
- Pathogenic Escherichia coli infection (4)
- Toll-like receptor signaling pathway (4)
- Allograft rejection (3)
- Autoimmune thyroid disease (3)
- Graft-versus-host disease (3)
- Type I diabetes mellitus (3)
- Ubiquitin mediated proteolysis (3)
- Viral myocarditis (3)
- B cell receptor signaling pathway (2)