Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Rabbit Polyclonal Anti-EWSR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the middle region of human EWSR1. Synthetic peptide located within the following region: QPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQS |
Rabbit Polyclonal Anti-ZNF71 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF71 antibody: synthetic peptide directed towards the middle region of human ZNF71. Synthetic peptide located within the following region: RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIH |
Rabbit Polyclonal Anti-DACH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DACH1 antibody: synthetic peptide directed towards the N terminal of human DACH1. Synthetic peptide located within the following region: MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASS |
Rabbit Polyclonal Anti-SFPQ Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFPQ antibody: synthetic peptide directed towards the N terminal of human SFPQ. Synthetic peptide located within the following region: VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Rabbit polyclonal MCM3 (Thr722) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MCM3 around the phosphorylation site of threonine 722. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TARDBP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the C terminal of human TARDBP. Synthetic peptide located within the following region: MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWG |
Rabbit Polyclonal Anti-HMGB2 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: DREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLS |
Rabbit Polyclonal Anti-HOXA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the C terminal of human HOXA5. Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG |
Rabbit Polyclonal Anti-HOXC8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXC8 antibody: synthetic peptide directed towards the N terminal of human HOXC8. Synthetic peptide located within the following region: SHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGD |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the N terminal of human HNRPD. Synthetic peptide located within the following region: AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTK |
Rabbit Polyclonal Anti-ILF3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ILF3 antibody: synthetic peptide directed towards the N terminal of human ILF3. Synthetic peptide located within the following region: ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR |
Rabbit Polyclonal RARA Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARA antibody: human RARA (Retinoic Acid Receptor alpha) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Transcription Factors
Filter by
Target Symbol
- RELA (41)
- TP53 (34)
- ESR1 (27)
- JUN (26)
- ATF2 (21)
- BRCA1 (21)
- CREB1 (21)
- SMAD3 (20)
- CTNNB1 (19)
- NFKB1 (19)
- NR3C1 (19)
- STAT1 (19)
- HDAC2 (18)
- SMAD1 (18)
- FOXO1 (17)
- STAT3 (17)
- STAT6 (17)
- IKBKB (15)
- SMAD2 (15)
- IKBKG (14)
- RB1 (14)
- AR (13)
- ELK1 (13)
- HDAC1 (13)
- HDAC5 (13)
- SOX2 (13)
- STAT5A (13)
- STAT5B (13)
- GATA6 (12)
- HDAC4 (12)
- JUNB (12)
- KDM1A (12)
- MYC (12)
- NFKBIB (12)
- RUNX1 (12)
- ABL1 (11)
- CCNE1 (11)
- FOS (11)
- FOXO4 (11)
- TP73 (11)
- DLX4 (10)
- ESR2 (10)
- GATA1 (10)
- HDAC6 (10)
- HNF4A (10)
- HNRNPD (10)
- IRF3 (10)
- JUND (10)
- MDM2 (10)
- MEF2A (10)
- PPARG (10)
- RELB (10)
- RORA (10)
- SMAD7 (10)
- TARDBP (10)
- THRB (10)
- XRCC6 (10)
- ATF4 (9)
- CEBPB (9)
- ENO1 (9)
- FOXA2 (9)
- HDAC8 (9)
- HNF1B (9)
- HSF1 (9)
- KEAP1 (9)
- MITF (9)
- MYB (9)
- NFE2L2 (9)
- NFKB2 (9)
- NRG1 (9)
- PIAS2 (9)
- REL (9)
- RUNX2 (9)
- STAT2 (9)
- SUMO1 (9)
- YBX1 (9)
- ATF1 (8)
- CALR (8)
- CDK7 (8)
- CUX1 (8)
- DDIT3 (8)
- E2F1 (8)
- EIF2AK2 (8)
- ERCC8 (8)
- EZH2 (8)
- FLI1 (8)
- FOXO3 (8)
- HCLS1 (8)
- HIF1A (8)
- HNF1A (8)
- KAT5 (8)
- MCM7 (8)
- MECOM (8)
- MTA2 (8)
- NPM1 (8)
- NR4A1 (8)
- PARP1 (8)
- PAX8 (8)
- POU2F1 (8)
- POU5F1 (8)
Applications
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Pathways in cancer (648)
- MAPK signaling pathway (352)
- Chronic myeloid leukemia (307)
- Prostate cancer (289)
- Cell cycle (281)
- Pancreatic cancer (245)
- Small cell lung cancer (224)
- Wnt signaling pathway (218)
- Neurotrophin signaling pathway (217)
- Acute myeloid leukemia (210)
- T cell receptor signaling pathway (202)
- Toll-like receptor signaling pathway (188)
- B cell receptor signaling pathway (180)
- Chemokine signaling pathway (177)
- Adipocytokine signaling pathway (176)
- Huntington's disease (174)
- TGF-beta signaling pathway (170)
- Colorectal cancer (169)
- Apoptosis (151)
- Jak-STAT signaling pathway (147)
- Cytosolic DNA-sensing pathway (133)
- RIG-I-like receptor signaling pathway (131)
- Thyroid cancer (116)
- Epithelial cell signaling in Helicobacter pylori infection (115)
- Ubiquitin mediated proteolysis (113)
- NOD-like receptor signaling pathway (108)
- ErbB signaling pathway (107)
- Endometrial cancer (104)
- Bladder cancer (94)
- Non-small cell lung cancer (92)
- Adherens junction (91)
- Melanoma (85)
- Basal transcription factors (84)
- Metabolic pathways (84)
- Melanogenesis (82)
- Basal cell carcinoma (76)
- Glioma (74)
- Renal cell carcinoma (74)
- p53 signaling pathway (73)
- Insulin signaling pathway (72)
- Maturity onset diabetes of the young (71)
- Focal adhesion (68)
- Notch signaling pathway (62)
- Amyotrophic lateral sclerosis (ALS) (56)
- GnRH signaling pathway (53)
- Nucleotide excision repair (53)
- Tight junction (51)
- Antigen processing and presentation (49)
- Oocyte meiosis (46)
- PPAR signaling pathway (46)
- Natural killer cell mediated cytotoxicity (42)
- Purine metabolism (42)
- Pyrimidine metabolism (42)
- Endocytosis (41)
- Axon guidance (39)
- DNA replication (38)
- Neuroactive ligand-receptor interaction (38)
- Pathogenic Escherichia coli infection (38)
- RNA polymerase (38)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (37)
- RNA degradation (31)
- Leukocyte transendothelial migration (28)
- VEGF signaling pathway (28)
- Type II diabetes mellitus (27)
- Viral myocarditis (25)
- Circadian rhythm - mammal (23)
- Alzheimer's disease (21)
- Base excision repair (21)
- Cytokine-cytokine receptor interaction (21)
- Spliceosome (21)
- Fc epsilon RI signaling pathway (19)
- Primary immunodeficiency (19)
- Systemic lupus erythematosus (18)
- Long-term potentiation (17)
- Dorso-ventral axis formation (16)
- Dilated cardiomyopathy (14)
- Hypertrophic cardiomyopathy (HCM) (14)
- Allograft rejection (13)
- Graft-versus-host disease (13)
- Prion diseases (13)
- Type I diabetes mellitus (13)
- Regulation of actin cytoskeleton (12)
- Fc gamma R-mediated phagocytosis (11)
- Non-homologous end-joining (10)
- Glycolysis / Gluconeogenesis (9)
- mTOR signaling pathway (9)
- Calcium signaling pathway (8)
- Vascular smooth muscle contraction (8)
- Asthma (7)
- Hematopoietic cell lineage (7)
- Homologous recombination (7)
- Long-term depression (7)
- Progesterone-mediated oocyte maturation (7)
- Autoimmune thyroid disease (6)
- Cell adhesion molecules (CAMs) (6)
- Cysteine and methionine metabolism (6)
- Hedgehog signaling pathway (5)
- Valine (5)
- Glycerolipid metabolism (4)
- Glycine (4)
- Glyoxylate and dicarboxylate metabolism (4)
- leucine and isoleucine degradation (4)
- serine and threonine metabolism (4)
- Biosynthesis of unsaturated fatty acids (3)
- Lysine degradation (3)
- Mismatch repair (2)
- Proteasome (2)
- Ribosome (2)
- SNARE interactions in vesicular transport (2)
- Aminoacyl-tRNA biosynthesis (1)
- Ether lipid metabolism (1)
- leucine and isoleucine biosynthesis (1)