Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Antibodies
View as table Download
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit Polyclonal Antibody against SLC29A1 (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 234-263 amino acids from the Central region of human ENT1. |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
Rabbit Polyclonal TACE Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit anti-SLC4A4 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC4A4 |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-GABRA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Calneuron-1 / CALN1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Calneuron-1 / CALN1 antibody was raised against a 16 amino acid peptide near the amino terminus of human CaBP8. |
Active filters
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Transmembrane
Citations
- Yes
Filter by
Category
Target Symbol
- ABCG2 (2)
- BAX (2)
- BDNF (2)
- HMOX1 (2)
- KDR (2)
- MTNR1A (2)
- PECAM1 (2)
- SIGMAR1 (2)
- SLC44A1 (2)
- ABCC4 (1)
- ABCC5 (1)
- ACER1 (1)
- ADAM10 (1)
- ADAM17 (1)
- ADCY1 (1)
- AGPAT2 (1)
- ANTXR1 (1)
- APP (1)
- AQP4 (1)
- BCL2L2 (1)
- CALN1 (1)
- CAMP (1)
- CANX (1)
- CAV1 (1)
- CD274 (1)
- CD276 (1)
- CD4 (1)
- CD44 (1)
- CDH2 (1)
- CDH5 (1)
- CELSR1 (1)
- CHRM1 (1)
- CHSY1 (1)
- CLDN2 (1)
- CUX1 (1)
- CX3CR1 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- CYP8B1 (1)
- DDR1 (1)
- DIABLO (1)
- DPAGT1 (1)
- EGFR (1)
- EXT1 (1)
- FAIM2 (1)
- FAP (1)
- FZD2 (1)
- FZD9 (1)
- G6PC (1)
- GABRA5 (1)
- GP9 (1)
- GPD2 (1)
- GPER1 (1)
- GPR183 (1)
- GRIA1 (1)
- GRIN2B (1)
- GRM2 (1)
- HAVCR1 (1)
- HLA-DRA (1)
- IFNB1 (1)
- IGF1R (1)
- ITGA4 (1)
- ITGA6 (1)
- ITGAX (1)
- ITGB6 (1)
- KLK5 (1)
- LAMP1 (1)
- LAMP2 (1)
- LTBR (1)
- MMP15 (1)
- NDUFA4L2 (1)
- NECTIN1 (1)
- NOTCH2 (1)
- NPC1L1 (1)
- NPHS1 (1)
- NPHS2 (1)
- NRP1 (1)
- NTRK2 (1)
- NTRK3 (1)
- OPN3 (1)
- P2RX1 (1)
- PLPP6 (1)
- RHBDD2 (1)
- S1PR3 (1)
- SCARB1 (1)
- SDC4 (1)
- SEMA3D (1)
- SGCA (1)
- SLC11A2 (1)
- SLC16A1 (1)
- SLC17A6 (1)
- SLC17A7 (1)
- SLC18A2 (1)
- SLC22A5 (1)
- SLC22A6 (1)
- SLC22A8 (1)
- SLC29A1 (1)
- SLC2A1 (1)
- SLC40A1 (1)
- SLC4A10 (1)
Conjugates
Modifications
Pathways
- Cell adhesion molecules (CAMs) (13)
- Neuroactive ligand-receptor interaction (12)
- Metabolic pathways (11)
- Cytokine-cytokine receptor interaction (9)
- Pathways in cancer (9)
- Focal adhesion (8)
- Colorectal cancer (7)
- ECM-receptor interaction (7)
- Huntington's disease (7)
- Calcium signaling pathway (6)
- Hematopoietic cell lineage (6)
- Neurotrophin signaling pathway (6)
- Regulation of actin cytoskeleton (6)
- Alzheimer's disease (5)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (5)
- Dilated cardiomyopathy (5)
- Endocytosis (5)
- Leukocyte transendothelial migration (5)
- MAPK signaling pathway (5)
- ABC transporters (4)
- Adherens junction (4)
- Amyotrophic lateral sclerosis (ALS) (4)
- Hypertrophic cardiomyopathy (HCM) (4)
- Toll-like receptor signaling pathway (4)
- Antigen processing and presentation (3)
- Apoptosis (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- Long-term potentiation (3)
- Lysosome (3)
- Melanogenesis (3)
- Parkinson's disease (3)
- Porphyrin and chlorophyll metabolism (3)
- Viral myocarditis (3)
- Adipocytokine signaling pathway (2)
- Axon guidance (2)
- Basal cell carcinoma (2)
- Chemokine signaling pathway (2)
- Dorso-ventral axis formation (2)
- Drug metabolism - cytochrome P450 (2)
- Drug metabolism - other enzymes (2)
- Gap junction (2)
- Glioma (2)
- Glycerophospholipid metabolism (2)
- GnRH signaling pathway (2)
- Long-term depression (2)
- Melanoma (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Natural killer cell mediated cytotoxicity (2)
- Notch signaling pathway (2)
- Oocyte meiosis (2)
- PPAR signaling pathway (2)
- Pancreatic cancer (2)
- Primary bile acid biosynthesis (2)
- Prion diseases (2)
- Progesterone-mediated oocyte maturation (2)
- Prostate cancer (2)
- Retinol metabolism (2)
- Starch and sucrose metabolism (2)
- Systemic lupus erythematosus (2)
- VEGF signaling pathway (2)
- Wnt signaling pathway (2)
- p53 signaling pathway (2)
- Allograft rejection (1)
- Androgen and estrogen metabolism (1)
- Ascorbate and aldarate metabolism (1)
- Asthma (1)
- Autoimmune thyroid disease (1)
- Bladder cancer (1)
- Chondroitin sulfate biosynthesis (1)
- Chronic myeloid leukemia (1)
- Cytosolic DNA-sensing pathway (1)
- Endometrial cancer (1)
- ErbB signaling pathway (1)
- Ether lipid metabolism (1)
- Galactose metabolism (1)
- Glycerolipid metabolism (1)
- Glycolysis / Gluconeogenesis (1)
- Graft-versus-host disease (1)
- Heparan sulfate biosynthesis (1)
- Insulin signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Linoleic acid metabolism (1)
- N-Glycan biosynthesis (1)
- Non-small cell lung cancer (1)
- Oxidative phosphorylation (1)
- Pathogenic Escherichia coli infection (1)
- Pentose and glucuronate interconversions (1)
- Primary immunodeficiency (1)
- Purine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Renal cell carcinoma (1)
- SNARE interactions in vesicular transport (1)
- Small cell lung cancer (1)
- Sphingolipid metabolism (1)
- T cell receptor signaling pathway (1)
- TGF-beta signaling pathway (1)
- Tight junction (1)
- Type I diabetes mellitus (1)
- Vascular smooth muscle contraction (1)