Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Normal Rabbit IgG rabbit polyclonal antibody, Purified
Rabbit Polyclonal tdTomato Antibody
| Applications | WB |
| Immunogen | tdTomato |
Rabbit Polyclonal mCherry Antibody
| Applications | WB |
| Immunogen | mCherry |
Rabbit Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Sheep |
| Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Rabbit Polyclonal mKate Antibody
| Applications | WB |
| Immunogen | Purified mKate protein expressed in E. coli. |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
PGK1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Peroxidase Conjugated Rabbit Anti-Goat IgG (gamma-chain specific)
| Applications | WB: 1:3,000-10,000; ELISA: 1:20,000-40,000 |
| Reactivities | Goat IgG |
| Conjugation | HRP |
| Immunogen | Goat IgG, whole molecule |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
EDG1 (S1PR1) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide derived from the C-terminal of the EDG-1 receptor |
Anti-MYC tag rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (EQKLISEEDL) conjugated to KLH |
Anti-His tag rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (HHHHHH) conjugated to KLH |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | A. victoria |
| Immunogen | Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria |
Rabbit Polyclonal eGFP Antibody
| Applications | WB |
| Immunogen | Purified eGFP protein expressed in E. coli. |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Rabbit Anti-Goat IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Goat IgG |
| Conjugation | Unconjugated |
| Immunogen | Goat IgG, whole molecule |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Active filters
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Citations
- Yes
Filter by
Target Symbol
- KDR (4)
- BAX (3)
- EGFP (3)
- GAPDH (3)
- MYC (3)
- PPARGC1A (3)
- ABCG2 (2)
- ADH5 (2)
- ANGPT2 (2)
- AOX1 (2)
- BAG3 (2)
- BRAF (2)
- CALCRL (2)
- CASP9 (2)
- CCNA2 (2)
- CCR6 (2)
- CDH2 (2)
- CHMP4C (2)
- COL1A1 (2)
- DDX58 (2)
- ELOVL5 (2)
- G6PC (2)
- GAD1 (2)
- GRIN2B (2)
- H3C1 (2)
- HA (2)
- HIF1A (2)
- HIS (2)
- HMOX1 (2)
- IPMK (2)
- IRS1 (2)
- MAP1LC3B (2)
- MAP3K5 (2)
- MAPK8 (2)
- MMP2 (2)
- MTNR1A (2)
- NOS3 (2)
- PECAM1 (2)
- PFKFB2 (2)
- PGF (2)
- RAC1 (2)
- RELA (2)
- SERPINA3 (2)
- SLC11A2 (2)
- SLC2A1 (2)
- SLC44A1 (2)
- STAT5A (2)
- TFAM (2)
- TSG101 (2)
- VCL (2)
- VEGFA (2)
- ABCB4 (1)
- ABCC2 (1)
- ABCC3 (1)
- ABCC4 (1)
- ABCC5 (1)
- ABCD2 (1)
- ABCD3 (1)
- ACER1 (1)
- ACSL3 (1)
- ACSL4 (1)
- ACTA2 (1)
- ACTB (1)
- ACTG2 (1)
- ADAM10 (1)
- ADAM17 (1)
- ADAMDEC1 (1)
- ADAMTS1 (1)
- ADAMTS16 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- AGPAT2 (1)
- AHCY (1)
- AHSP (1)
- AICDA (1)
- AIM2 (1)
- AIMP1 (1)
- AKAP12 (1)
- AKT1 (1)
- ALPG (1)
- ANAPC10 (1)
- ANGPTL8 (1)
- ANTXR1 (1)
- AP1M1 (1)
- AP1S1 (1)
- APAF1 (1)
- APOA1 (1)
- APOBEC3B (1)
- AQP4 (1)
- ARAP1 (1)
- ARSA (1)
- ASAH1 (1)
- ATG5 (1)
- ATP6V1H (1)
- ATRX (1)
- ATXN1 (1)
- AURKB (1)
- AUTS2 (1)
- AZGP1 (1)
- B3GLCT (1)
Reactivities
- Human (547)
- Mouse (394)
- Rat (313)
- Bovine (24)
- Pig (13)
- Xenopus (11)
- Chicken (8)
- Monkey (8)
- Dog (7)
- Gorilla (6)
- Hamster (6)
- Rhesus Monkey (6)
- Zebrafish (6)
- Chimpanzee (5)
- Rabbit (5)
- X. tropicalis (4)
- Horse (3)
- Porcine (3)
- Bat (2)
- Cow (2)
- Drosophila (2)
- Sheep (2)
- Feline (1)
- Gibbon (1)
- Goat (1)
- Murine (1)
- Orang-Utan (1)
- Primate (1)
- Tadpole (1)
Applications
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Families
- Druggable Genome (385)
- Transmembrane (186)
- Transcription Factors (75)
- Secreted Protein (57)
- ES Cell Differentiation/IPS (55)
- Protein Kinase (46)
- GPCR (20)
- Protease (20)
- Stem cell - Pluripotency (14)
- Adult stem cells (8)
- Cancer stem cells (7)
- Embryonic stem cells (7)
- Nuclear Hormone Receptor (7)
- P450 (5)
- Stem cell relevant signaling - DSL/Notch pathway (5)
- Stem cell relevant signaling - JAK/STAT signaling pathway (5)
- Induced pluripotent stem cells (4)
- Ion Channels: Other (3)
- Ion Channels: Transient receptor potential (3)
- Phosphatase (3)
- Ion Channels: Cys-loop Receptors (2)
- Ion Channels: Glutamate Receptors (2)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (2)
- Stem cell relevant signaling - Wnt Signaling pathway (2)
- Ion Channels: Calcium (1)
Pathways
- Pathways in cancer (77)
- Metabolic pathways (57)
- Focal adhesion (48)
- MAPK signaling pathway (35)
- Pancreatic cancer (29)
- Regulation of actin cytoskeleton (29)
- Colorectal cancer (27)
- Chemokine signaling pathway (26)
- Neurotrophin signaling pathway (25)
- Small cell lung cancer (24)
- Prostate cancer (23)
- Toll-like receptor signaling pathway (23)
- Adipocytokine signaling pathway (22)
- Cytokine-cytokine receptor interaction (22)
- Alzheimer's disease (21)
- Chronic myeloid leukemia (21)
- Insulin signaling pathway (21)
- Leukocyte transendothelial migration (21)
- Endocytosis (20)
- Huntington's disease (20)
- Apoptosis (19)
- ErbB signaling pathway (19)
- Renal cell carcinoma (19)
- VEGF signaling pathway (18)
- Amyotrophic lateral sclerosis (ALS) (17)
- ECM-receptor interaction (17)
- Natural killer cell mediated cytotoxicity (17)
- Neuroactive ligand-receptor interaction (17)
- RIG-I-like receptor signaling pathway (17)
- p53 signaling pathway (17)
- Adherens junction (16)
- Jak-STAT signaling pathway (16)
- Acute myeloid leukemia (15)
- Bladder cancer (15)
- Glioma (15)
- Melanoma (15)
- Progesterone-mediated oocyte maturation (15)
- Wnt signaling pathway (15)
- Axon guidance (14)
- Cell adhesion molecules (CAMs) (14)
- Cell cycle (14)
- Non-small cell lung cancer (14)
- Vascular smooth muscle contraction (14)
- B cell receptor signaling pathway (13)
- Calcium signaling pathway (13)
- Epithelial cell signaling in Helicobacter pylori infection (13)
- Fc epsilon RI signaling pathway (13)
- NOD-like receptor signaling pathway (13)
- T cell receptor signaling pathway (13)
- Endometrial cancer (12)
- Viral myocarditis (12)
- Fc gamma R-mediated phagocytosis (11)
- Gap junction (11)
- Glycolysis / Gluconeogenesis (11)
- GnRH signaling pathway (11)
- Cytosolic DNA-sensing pathway (10)
- Lysosome (10)
- Type II diabetes mellitus (10)
- mTOR signaling pathway (10)
- ABC transporters (9)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (9)
- Dilated cardiomyopathy (9)
- Hematopoietic cell lineage (9)
- Long-term depression (9)
- Parkinson's disease (9)
- TGF-beta signaling pathway (9)
- Tight junction (9)
- Hypertrophic cardiomyopathy (HCM) (8)
- Pathogenic Escherichia coli infection (8)
- Complement and coagulation cascades (7)
- Melanogenesis (7)
- PPAR signaling pathway (7)
- Prion diseases (7)
- Type I diabetes mellitus (7)
- Drug metabolism - cytochrome P450 (6)
- Long-term potentiation (6)
- Oocyte meiosis (6)
- Oxidative phosphorylation (6)
- Porphyrin and chlorophyll metabolism (6)
- Sphingolipid metabolism (6)
- Thyroid cancer (6)
- Metabolism of xenobiotics by cytochrome P450 (5)
- Systemic lupus erythematosus (5)
- Tyrosine metabolism (5)
- Ubiquitin mediated proteolysis (5)
- Allograft rejection (4)
- Antigen processing and presentation (4)
- Arginine and proline metabolism (4)
- Basal cell carcinoma (4)
- Citrate cycle (TCA cycle) (4)
- Dorso-ventral axis formation (4)
- Fatty acid metabolism (4)
- Fructose and mannose metabolism (4)
- Galactose metabolism (4)
- Retinol metabolism (4)
- Starch and sucrose metabolism (4)
- Alanine (3)
- Androgen and estrogen metabolism (3)
- Autoimmune thyroid disease (3)
- Butanoate metabolism (3)
- Cardiac muscle contraction (3)
- Cysteine and methionine metabolism (3)
- Glycerophospholipid metabolism (3)
- Graft-versus-host disease (3)
- Homologous recombination (3)
- Notch signaling pathway (3)
- Purine metabolism (3)
- Regulation of autophagy (3)
- SNARE interactions in vesicular transport (3)
- Taurine and hypotaurine metabolism (3)
- Tryptophan metabolism (3)
- Valine (3)
- aspartate and glutamate metabolism (3)
- beta-Alanine metabolism (3)
- leucine and isoleucine degradation (3)
- Biosynthesis of unsaturated fatty acids (2)
- DNA replication (2)
- Drug metabolism - other enzymes (2)
- Ether lipid metabolism (2)
- Folate biosynthesis (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Inositol phosphate metabolism (2)
- Linoleic acid metabolism (2)
- Maturity onset diabetes of the young (2)
- Methane metabolism (2)
- Mismatch repair (2)
- N-Glycan biosynthesis (2)
- Nicotinate and nicotinamide metabolism (2)
- Olfactory transduction (2)
- Pentose phosphate pathway (2)
- Primary bile acid biosynthesis (2)
- RNA degradation (2)
- Renin-angiotensin system (2)
- Selenoamino acid metabolism (2)
- Spliceosome (2)
- Vibrio cholerae infection (2)
- Vitamin B6 metabolism (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Arachidonic acid metabolism (1)
- Ascorbate and aldarate metabolism (1)
- Asthma (1)
- Base excision repair (1)
- Chondroitin sulfate biosynthesis (1)
- Circadian rhythm - mammal (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glycosaminoglycan degradation (1)
- Hedgehog signaling pathway (1)
- Heparan sulfate biosynthesis (1)
- Nucleotide excision repair (1)
- O-Glycan biosynthesis (1)
- Other glycan degradation (1)
- Pentose and glucuronate interconversions (1)
- Phosphatidylinositol signaling system (1)
- Primary immunodeficiency (1)
- Propanoate metabolism (1)
- Proteasome (1)
- Pyruvate metabolism (1)
- Ribosome (1)
- Taste transduction (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- alpha-Linolenic acid metabolism (1)
- serine and threonine metabolism (1)