Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal LIMK1/2 (Thr508/505) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human LIMK1/2 around the phosphorylation site of Threonine 508/505 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit polyclonal anti-Vinculin antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VCL |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit anti-CHRM5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM5 |
Rabbit Polyclonal Anti-CHRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHRM1 |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Regulation of actin cytoskeleton
Filter by
Target Symbol
- EGFR (28)
- EZR (18)
- RAF1 (15)
- MAPK1 (12)
- PAK1 (12)
- PTK2 (12)
- PXN (12)
- MAP2K1 (11)
- ROCK2 (11)
- BRAF (10)
- FGFR1 (10)
- MAPK3 (10)
- PDGFRB (10)
- CFL1 (9)
- VCL (9)
- BCAR1 (7)
- LIMK1 (7)
- PAK2 (7)
- PIK3R1 (7)
- RHOA (7)
- SHC1 (7)
- LIMK2 (6)
- PDGFRA (6)
- VAV1 (6)
- FGF4 (5)
- FGFR3 (5)
- ITGB1 (5)
- ITGB4 (5)
- MAP2K2 (5)
- PDGFB (5)
- PPP1CB (5)
- APC (4)
- CHRM1 (4)
- FGF2 (4)
- FGFR2 (4)
- FN1 (4)
- ITGB3 (4)
- NRAS (4)
- PAK3 (4)
- PFN1 (4)
- ROCK1 (4)
- ACTN1 (3)
- ARAF (3)
- BAIAP2 (3)
- CDC42 (3)
- CRK (3)
- CSK (3)
- EGF (3)
- F2 (3)
- FGF1 (3)
- ITGA4 (3)
- ITGB5 (3)
- MSN (3)
- PAK4 (3)
- PAK5 (3)
- PDGFA (3)
- PPP1R12A (3)
- RAC1 (3)
- ACTN4 (2)
- ARHGAP35 (2)
- BDKRB2 (2)
- CFL2 (2)
- CHRM2 (2)
- CHRM5 (2)
- F2R (2)
- FGF7 (2)
- FGFR4 (2)
- GIT1 (2)
- GNA13 (2)
- GSN (2)
- HRAS (2)
- ITGA7 (2)
- ITGAL (2)
- ITGAV (2)
- ITGAX (2)
- ITGB2 (2)
- MYLK (2)
- PDGFC (2)
- PIKFYVE (2)
- PPP1CA (2)
- PPP1CC (2)
- RRAS (2)
- SLC9A1 (2)
- WAS (2)
- WASF2 (2)
- ARHGEF6 (1)
- CHRM3 (1)
- CHRM4 (1)
- CRKL (1)
- DIAPH1 (1)
- DOCK1 (1)
- FGF10 (1)
- FGF23 (1)
- FGF3 (1)
- FGF8 (1)
- INS (1)
- ITGA5 (1)
- ITGAM (1)
- ITGB6 (1)
- KRAS (1)