GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-SEPT2 Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the N terminal of human SEPT2. Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK |
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Rabbit polyclonal antibody to HN1 (hematological and neurological expressed 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 166 of HN1 (Uniprot ID#Q9UK76 isoform2) |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit Polyclonal Anti-HSD3B1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Horse, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
FBL Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FBL |
Rabbit polyclonal anti-PCNA antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PCNA |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Rabbit Polyclonal Anti-HSD17B11 Antibody
| Applications | IHC |
| Reactivities | Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
ADRB3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADRB3 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey (94%). |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal GOT2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit anti-S100A10 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human S100A10 |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
USD 415.00
In Stock
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
FPR2 / FPRL1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FPR2 / FPRL1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human FPR2 / FPRL1. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Monkey (95%); Orangutan (90%); Dog (85%). |
OLFM4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | OLFM4 / Olfactomedin 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset (100%); Guinea pig (94%); Orangutan, Rat, Hamster, Dog, Rabbit (88%); Galago, Mouse, Panda, Horse (81%). |
Optineurin Rabbit Polyclonal (aa575-591) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | OPTN / Optineurin antibody was raised against synthetic peptide corresponding to aa 559-575 (GEVLPDIDTLQIHVMDC) of human, mouse and rat optineurin |
B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%). |
Germany
Japan
United Kingdom
China
