Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-17E |
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-17E |
Biotinylated Anti-Human IL-17F Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-17F |
Rabbit polyclonal antibody to CACNA1B (calcium channel, voltage-dependent, N type, alpha 1B subunit)
Applications | IF, IP, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2013 and 2209 of CACNA1B (Uniprot ID#Q00975) |
Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Biotinylated Anti-Human G-CSF Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human G-CSF |
Rabbit Polyclonal Anti-GPA33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPA33 |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Rabbit Polyclonal Anti-NOX4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4. |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Conjugation | Biotin |
Immunogen | Collagen Type I from Human and Bovine placenta. |
Rabbit Polyclonal PD-L1 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
Modifications | Phospho-specific |
Biotinylated Anti-Human IL-21 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-21 |
Rabbit Polyclonal VLK Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
SNAIL (SNAI1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic phosphopeptide derived from human SNAI 1 around the phosphorylation site of Serine 246. |
Rabbit anti-Nono Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A specific peptide of human Nono |
Rabbit anti-BRCA1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit Polyclonal Anti-BDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor). |
Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
Rabbit Polyclonal Lipase A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571] |
Rabbit anti-REG3A Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human REG3A |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
SEMA3G (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 216-244 amino acids from the Central region of Human SEMA3G |
Rabbit anti-IRF3 Polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IRF3 |
beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1. |
Rabbit Polyclonal Anti-Amyloid Oligomers (A11) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Eukaryotes |
Conjugation | Unconjugated |
Immunogen | Synthetic molecular mimic of soluble oligomers. |
Rabbit Polyclonal Antibody against Eg5
Applications | WB |
Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
Conjugation | Unconjugated |
Immunogen | Produced by immunization of rabbits with a recombinant segment of the coiled-coil domain of the human protein. |
Rabbit Polyclonal IRAK-M Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
EPO (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 20-48 amino acids from the N-terminal region of Human Erythropoietin. |
CTLA4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 50-78 amino acids from the N-terminal region of Human CD152 / CTLA4. |
Rabbit Polyclonal Nephrin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Anti-Human IL-17F Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-17F |
Rabbit Polyclonal Ogg1 Antibody
Applications | IHC, WB |
Reactivities | Human, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human Ogg1 (within amino acids 1-100). |
PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit Polyclonal Anti-PFKFB2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
USD 428.00
In Stock
Rabbit monoclonal anti-WT1 Antibody, clone OTIR5F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |