Antibodies

View as table Download

Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus.

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 880-930 of Human CD13.

Rabbit Polyclonal MAS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human MAS1 protein (between residues 75-125) [UniProt P04201]

Rabbit polyclonal CTSA / PPGB (32k, Cleaved-Arg326) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PPGB

Rabbit Polyclonal Anti-AGTR1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI

Rabbit Polyclonal Anti-CMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CMA1 antibody: synthetic peptide directed towards the C terminal of human CMA1. Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA

Rabbit anti-ANPEP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANPEP

Rabbit Polyclonal AGTR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR2 antibody was raised against a 16 amino acid peptide from near the center of human AGTR2.

Rabbit polyclonal Neprilysin Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin.

Rabbit anti-CTSA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CTSA

Rabbit anti-MME Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MME

Rabbit Polyclonal Anti-ACE2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACE2 Antibody: A synthesized peptide

Rabbit Polyclonal Aminopeptidase A/APA Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Leucyl cystinyl aminopeptidase (LNPEP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 16-46 amino acids from the N-terminal region of Human LNPEP.

Anti-AGT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-41 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8)

Rabbit Polyclonal Anti-REN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-REN antibody: synthetic peptide directed towards the C terminal of human REN. Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA

Rabbit Polyclonal Anti-Cathepsin G Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G

Rabbit Polyclonal Anti-ACE1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ACE2 antibody was raised against synthetic peptide

Angiotensin Converting Enzyme 2 (ACE2) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ACE2 antibody was raised against synthetic peptide

Aminopeptidase A (ENPEP) (689-032) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 689 and 932 of Human ENPEP

Angiotensin II Type 1 Receptor (AGTR1) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated, Synthetic peptide

CPA3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of Human CPA3.

Aminopeptidase A (ENPEP) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 906-938 amino acids from the C-terminal region of Human ENPEP.

Rabbit Polyclonal ACE2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the center of human ACE2.

Rabbit Polyclonal ACE2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the C-terminus of human ACE2.

Rabbit Polyclonal ACE2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the N-terminus of human ACE2.

Rabbit Polyclonal ACE2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the center of human ACE2.

Rabbit Polyclonal antibody to Angiotensinogen (angiotensinogen (serpin peptidase inhibitor, clade A, member 8))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 476 of Angiotensinogen (Uniprot ID#P01019)

Rabbit polyclonal anti-REN antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human REN.

Anti-AGT Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-41 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8)

Rabbit polyclonal MME Antibody (Center)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME.

Rabbit Polyclonal Anti-THOP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THOP1 antibody is: synthetic peptide directed towards the C-terminal region of Human THOP1. Synthetic peptide located within the following region: MDYRSCILRPGGSEDASAMLRRFLGRDPKQDAFLLSKGLQVGGCEPEPQV

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII

Rabbit Polyclonal MAS1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Cathepsin G (CTSG) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 71-120 of Human Cathepsin G.

Angiotensin Converting Enzyme 1 (ACE) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CTSA (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 25-53 amino acids from the N-terminal region of human CTSA

Rabbit Polyclonal antibody to Angiotensinogen (angiotensinogen (serpin peptidase inhibitor, clade A, member 8))

Reactivities Human

Rabbit Polyclonal antibody to Renin (renin)

Applications IHC, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 70 and 332 of Renin (Uniprot ID#P00797)

Rabbit polyclonal CATG (Cleaved-Ile21) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CATG.

Rabbit Polyclonal LNPEP Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen LNPEP antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human LNPEP.

Rabbit polyclonal MME Antibody (Center)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 721-747 amino acids from the C-terminal region of human MME.

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI

Rabbit Polyclonal Anti-ANPEP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse

AGTR2 / AT2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rat, Sheep, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen AGTR2 / AT2 Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human AGTR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Pig (100%).