Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal CCL2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2. |
Rabbit polyclonal PDGFRB Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PDGFRB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-72 amino acids from the N-terminal region of human PDGFRB. |
Rabbit Polyclonal CXCR4 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4. |
Rabbit Polyclonal DR3 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | DR3 antibody was raised against a 20 amino acid peptide near the carboxy terminus of human DR3. The immunogen is located within the last 50 amino acids of DR3. |
Rabbit Polyclonal IL-1RAcP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-1RAcP antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-1RAcP. The immunogen is located within the last 50 amino acids of IL-1RAcP. |
Rabbit Polyclonal IL-17 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IL-17 antibody was raised against a 19 amino acid synthetic peptide from near the center of human IL-17A. The immunogen is located within amino acids 50 - 100 of IL-17. |
Rabbit Polyclonal antibody to IL1 receptor 2 (interleukin 1 receptor, type II)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 172 and 398 of IL1 Receptor 2 (Uniprot ID#P27930) |
Rabbit polyclonal anti-GPR42 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR42. |
Rabbit polyclonal IL10RA Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL10RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-175 amino acids from the Central region of human IL10RA. |
Rabbit polyclonal EGFR (Thr678) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 678 (K-R-TP-L-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal IL-2Ra/CD25 (Ser268) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-2Ra/CD25 around the phosphorylation site of serine 268 (R-K-SP-R-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CSF1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP |
Rabbit Polyclonal Anti-CSF1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG |
Rabbit Polyclonal Anti-IL-11 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-11 antibody was raised against a 16 amino acid peptide from near the amino terminus of human IL-11. The immunogen is located within amino acids 40 - 90 of IL-11. |
Rabbit anti-FLT3 polyclonal antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman FLT3 around the phosphorylation site of tyrosine 591 (Y-F-YP-V-D). |
Rabbit polyclonal anti-MET (met proto-oncogene) antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MET |
| Modifications | Phospho-specific |
Active filters
Applications
- IF
Isotypes
- IgG
Conjugates
- Unconjugated
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Category
Target Symbol
- CX3CR1 (3)
- CXCR4 (3)
- MET (3)
- TNFRSF25 (3)
- CCL2 (2)
- CCR7 (2)
- CSF1 (2)
- CSF1R (2)
- EGFR (2)
- FLT3 (2)
- IFNB1 (2)
- IL1RAP (2)
- IL23A (2)
- NGFR (2)
- PDGFRB (2)
- TNFRSF10A (2)
- TNFRSF10C (2)
- TNFRSF14 (2)
- TNFSF10 (2)
- TNFSF4 (2)
- VEGFA (2)
- ACVR1B (1)
- ACVRL1 (1)
- BMPR1B (1)
- CCL11 (1)
- CCL17 (1)
- CCR3 (1)
- CCR5 (1)
- CRLF2 (1)
- CXCL8 (1)
- CXCR2 (1)
- CXCR3 (1)
- EDA (1)
- FLT1 (1)
- FLT4 (1)
- IFNA2 (1)
- IFNL3 (1)
- IL10RA (1)
- IL11 (1)
- IL12A (1)
- IL17A (1)
- IL17RA (1)
- IL1R2 (1)
- IL21 (1)
- IL21R (1)
- IL22 (1)
- IL22RA1 (1)
- IL2RA (1)
- IL7R (1)
- IL9 (1)
- IL9R (1)
- INHBA (1)
- KDR (1)
- KITLG (1)
- LIF (1)
- LTB (1)
- LTBR (1)
- PDGFB (1)
- PDGFRA (1)
- PF4V1 (1)
- RELT (1)
- TGFBR2 (1)
- TNF (1)
- TNFRSF10B (1)
- TNFRSF10D (1)
- TNFRSF12A (1)
- TNFRSF13B (1)
- TNFRSF17 (1)
- TNFRSF1B (1)
- TNFRSF4 (1)
- TNFRSF6B (1)
- TNFSF11 (1)
- TNFSF13 (1)
- TNFSF13B (1)
- TNFSF14 (1)
- TNFSF15 (1)
- TNFSF18 (1)
- TSLP (1)