Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal VGF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VGF antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of the human VGF. The immunogen is located within the last 50 amino acids of VGF. |
Chicken Polyclonal Albumin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Albumin antibody was raised against a 13 amino acid synthetic peptide near the center of human Albumin. The immunogen is located within amino acids 340 - 390 of Albumin. |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit Polyclonal NPTX2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | NPTX2 antibody was raised against a 16 amino acid synthetic peptide near the center of the human NPTX2. The immunogen is located within amino acids 170 - 220 of NPTX2. |
Rabbit polyclonal PCSK2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PCSK2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 87-116 amino acids from the N-terminal region of human PCSK2. |
USD 484.00
In Stock
Rabbit polyclonal antibody to Factor XIIIa (coagulation factor XIII, A1 polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 258 of Factor XIIIa (Uniprot ID#P00488) |
Rabbit Polyclonal AFP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AFP antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human AFP. The immunogen is located within amino acids 340 - 390 of AFP. |
ANXA2 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANXA2 |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal MD-2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MD-2 antibody was raised against a peptide corresponding to 13 amino acids near the center of human MD-2. The immunogen is located within the last 50 amino acids of MD-2. |
Rabbit Polyclonal OVGP1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OVGP1 antibody was raised against an 18 amino acid synthetic peptide from near the amino terminus of human OVGP1. The immunogen is located within amino acids 60 - 110 of OVGP1. |
Chicken Polyclonal ApoA1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ApoA1 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ApoA1. The immunogen is located within the first 50 amino acids of ApoA1. |
Active filters
Reactivities
- Rat
Applications
- IF
Families
- Secreted Protein
Filter by
Category
Target Symbol
- LOX (62)
- SYP (50)
- RAB37 (30)
- SYT4 (28)
- MTMR14 (25)
- SIL1 (25)
- FGFR2 (23)
- CPA2 (20)
- EGFR (17)
- NOG (15)
- SHH (11)
- PMEL (10)
- VEGFB (10)
- F13A1 (9)
- BMP4 (8)
- TGFB1 (8)
- STX1A (6)
- DPP4 (5)
- FGF1 (5)
- FGF2 (5)
- KLK8 (5)
- NTF4 (5)
- POSTN (5)
- RNPEP (5)
- SLC30A3 (5)
- SPINT1 (5)
- LGALS3 (4)
- CALR (3)
- TAC1 (3)
- ADIPOQ (2)
- C1QTNF4 (2)
- C1QTNF7 (2)
- CCL2 (2)
- FGF12 (2)
- IL16 (2)
- MANF (2)
- MATN3 (2)
- PLXDC1 (2)
- SHBG (2)
- SPP1 (2)
- TNF (2)
- WNT10A (2)
- ADAMTSL5 (1)
- AFP (1)
- ALB (1)
- ANG (1)
- ANGPTL3 (1)
- ANGPTL4 (1)
- ANXA2 (1)
- APOA1 (1)
- APOH (1)
- ASPN (1)
- BDNF (1)
- C1QTNF1 (1)
- C1QTNF2 (1)
- C1QTNF6 (1)
- CAMP (1)
- CBLN1 (1)
- CCDC134 (1)
- CCL17 (1)
- CHAD (1)
- CLU (1)
- CNTN4 (1)
- CTHRC1 (1)
- DRAXIN (1)
- EBI3 (1)
- ECRG4 (1)
- EDA (1)
- EFEMP1 (1)
- EPOR (1)
- ERBB3 (1)
- FGF23 (1)
- FLT1 (1)
- GABBR1 (1)
- GAL (1)
- GCG (1)
- GDF1 (1)
- GDNF (1)
- GZMK (1)
- HAPLN2 (1)
- IL22 (1)
- IL33 (1)
- INHBA (1)
- INS (1)
- KL (1)
- LGI1 (1)
- LIF (1)
- LY96 (1)
- MATN4 (1)
- MUC1 (1)
- NENF (1)
- NPTX2 (1)
- NPY (1)
- NUCB2 (1)
- OVGP1 (1)
- PAPPA2 (1)
- PCSK2 (1)
- PLA1A (1)
- PON1 (1)
- PRSS12 (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (94)
- MAPK signaling pathway (69)
- Regulation of actin cytoskeleton (54)
- Cytokine-cytokine receptor interaction (50)
- Endocytosis (42)
- Prostate cancer (41)
- Pancreatic cancer (36)
- TGF-beta signaling pathway (34)
- Focal adhesion (32)
- Melanoma (30)
- Bladder cancer (28)
- Colorectal cancer (25)
- Basal cell carcinoma (22)
- Hedgehog signaling pathway (22)
- Renal cell carcinoma (19)
- Calcium signaling pathway (18)
- ErbB signaling pathway (18)
- Adherens junction (17)
- Dorso-ventral axis formation (17)
- Endometrial cancer (17)
- Epithelial cell signaling in Helicobacter pylori infection (17)
- Gap junction (17)
- Glioma (17)
- GnRH signaling pathway (17)
- Non-small cell lung cancer (17)
- mTOR signaling pathway (12)
- Complement and coagulation cascades (11)
- Dilated cardiomyopathy (10)
- Hypertrophic cardiomyopathy (HCM) (10)
- Cell cycle (8)
- Chronic myeloid leukemia (8)
- Adipocytokine signaling pathway (6)
- Neurotrophin signaling pathway (6)
- SNARE interactions in vesicular transport (6)
- Toll-like receptor signaling pathway (5)
- Type II diabetes mellitus (5)
- NOD-like receptor signaling pathway (4)
- PPAR signaling pathway (4)
- Amyotrophic lateral sclerosis (ALS) (3)
- Antigen processing and presentation (3)
- Chemokine signaling pathway (3)
- ECM-receptor interaction (3)
- Hematopoietic cell lineage (3)
- Jak-STAT signaling pathway (3)
- Melanogenesis (3)
- Type I diabetes mellitus (3)
- Wnt signaling pathway (3)
- Allograft rejection (2)
- Alzheimer's disease (2)
- Apoptosis (2)
- Asthma (2)
- Fc epsilon RI signaling pathway (2)
- Graft-versus-host disease (2)
- Natural killer cell mediated cytotoxicity (2)
- RIG-I-like receptor signaling pathway (2)
- Systemic lupus erythematosus (2)
- T cell receptor signaling pathway (2)
- Cytosolic DNA-sensing pathway (1)
- Huntington's disease (1)
- Insulin signaling pathway (1)
- Maturity onset diabetes of the young (1)
- Metabolic pathways (1)
- Neuroactive ligand-receptor interaction (1)
- Oocyte meiosis (1)
- Pathogenic Escherichia coli infection (1)
- Progesterone-mediated oocyte maturation (1)
- Regulation of autophagy (1)
- VEGF signaling pathway (1)
- p53 signaling pathway (1)