Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Antibodies
View as table Download
ENaC Gamma Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide from human SCNN1G. |
Rabbit polyclonal SCNN1A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCNN1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 365-391 amino acids from the Central region of human SCNN1A. |
Rabbit polyclonal Anti-KCNAB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Rabbit anti-CLCN1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN1 |
ENaC Gamma Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide C-SNQLTDTQMLDE from the C-terminus of human SCNN1G (NP_001030.2). Percent identity by BLAST analysis: Human, Gorilla, Marmoset (100%); Monkey (92%); Elephant (83%). |
Rabbit polyclonal CACNA2D2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit polyclonal CLC4 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CLC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 663-689 amino acids from the C-terminal region of human CLC4. |
Rabbit polyclonal anti-GJA3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GJA3. |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit Polyclonal Anti-KCNAB3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB3 antibody: synthetic peptide directed towards the N terminal of human KCNAB3. Synthetic peptide located within the following region: RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV |
Rabbit Polyclonal Anti-GJA4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJA4 antibody: synthetic peptide directed towards the middle region of human GJA4. Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA |
BEST4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | BEST4 antibody was raised against synthetic 15 amino acid peptide from internal region of human BEST4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rabbit (93%); Hamster (87%); Pig (80%). |
Rabbit polyclonal Anti-KCNAB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Rabbit Polyclonal Anti-CYBB Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Rabbit Polyclonal Anti-CLCC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLCC1 Antibody: synthetic peptide directed towards the N terminal of human CLCC1. Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW |
Rabbit Polyclonal Anti-KCNIP4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4. Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL |
Rabbit Polyclonal Anti-CLIC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF |
Rabbit Polyclonal Anti-VDAC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV |
Rabbit Polyclonal Anti-ACCN3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACCN3 antibody: synthetic peptide directed towards the N terminal of human ACCN3. Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL |
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF |
Rabbit Polyclonal Anti-CLIC5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC5 antibody: synthetic peptide directed towards the C terminal of human CLIC5. Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
Rabbit Polyclonal Anti-CLIC5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC5 antibody: synthetic peptide directed towards the C terminal of human CLIC5. Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
Rabbit Polyclonal Anti-KCNH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the N terminal of human KCNH6. Synthetic peptide located within the following region: GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK |
Rabbit Polyclonal Anti-KCTD6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCTD6 antibody: synthetic peptide directed towards the N terminal of human KCTD6. Synthetic peptide located within the following region: HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN |
Active filters
Category
- Antibodies
Applications
- IHC
Conjugates
- Unconjugated
Families
- Ion Channels: Other
Filter by
Target Symbol
- KCNAB1 (16)
- KCTD14 (15)
- FXYD3 (9)
- AQP1 (6)
- CLCA1 (4)
- CYBB (4)
- GJA1 (4)
- KCTD13 (4)
- NUDT9 (4)
- VDAC1 (4)
- KCNH6 (3)
- KCTD5 (3)
- TOMM40 (3)
- ABCC4 (2)
- BEST4 (2)
- CACNB1 (2)
- CLCA4 (2)
- CLIC1 (2)
- CLIC4 (2)
- CLIC5 (2)
- GJB1 (2)
- GJD2 (2)
- KCNAB2 (2)
- KCNMB2 (2)
- KCNMB4 (2)
- NOX1 (2)
- SCNN1A (2)
- SCNN1G (2)
- TNFAIP1 (2)
- VDAC2 (2)
- ASIC1 (1)
- ASIC3 (1)
- BEST1 (1)
- CACNA2D2 (1)
- CACNB2 (1)
- CACNG6 (1)
- CATSPER1 (1)
- CATSPER3 (1)
- CATSPER4 (1)
- CHRFAM7A (1)
- CLCC1 (1)
- CLCN1 (1)
- CLCN3 (1)
- CLCN4 (1)
- CLIC3 (1)
- CLNS1A (1)
- FXYD1 (1)
- FXYD7 (1)
- GJA3 (1)
- GJA4 (1)
- GJA8 (1)
- GJB2 (1)
- GJB4 (1)
- GJB5 (1)
- GJC1 (1)
- GJC2 (1)
- KCNAB3 (1)
- KCNG3 (1)
- KCNIP1 (1)
- KCNIP2 (1)
- KCNIP4 (1)
- KCNMB3 (1)
- KCTD15 (1)
- KCTD6 (1)
- MLC1 (1)
- SHKBP1 (1)
- TPCN2 (1)
- VDAC3 (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Modifications
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (9)
- Calcium signaling pathway (7)
- Huntington's disease (7)
- Parkinson's disease (7)
- Gap junction (6)
- Leukocyte transendothelial migration (6)
- Olfactory transduction (6)
- Cardiac muscle contraction (5)
- Dilated cardiomyopathy (5)
- Hypertrophic cardiomyopathy (HCM) (5)
- MAPK signaling pathway (5)
- Vascular smooth muscle contraction (5)
- Purine metabolism (4)
- Taste transduction (4)
- Amyotrophic lateral sclerosis (ALS) (3)
- ABC transporters (2)