Rabbit anti-CDK4 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK4 |
Rabbit anti-CDK4 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK4 |
PLK1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLK1 |
Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Phospho-CDK1-T161 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T161 of human CDK1 |
Modifications | Phospho-specific |
Phospho-CDK2-T160 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T160 of human CDK2 |
Modifications | Phospho-specific |
Rabbit polyclonal anti-DNA-PK antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human DNA-PK. |
Rabbit polyclonal TTK (Ab-676) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit polyclonal CDK4 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Phospho-CDK6-Y13 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6 |
Modifications | Phospho-specific |
Mouse Monoclonal GSK-3 beta Antibody (3D10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ABL1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ABL1 |
Mouse Monoclonal DNA-PKcs Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal BubR1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal Chk1 (Ser296) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk1 around the phosphorylation site of serine 296 (I-Q-SP-N-L). |
Modifications | Phospho-specific |
CDK1 / CDC2 Mouse Monoclonal (26E11) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GSK3B / GSK3 Beta Rabbit Polyclonal (pSer9) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GSK3B / GSK3 Beta antibody was raised against synthetic peptide from human GSK3B / GSK3 Beta. |
Mouse Monoclonal DNA-PKcs Antibody (3H6)
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal ATM Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ATM antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human ATM. |
Rabbit polyclonal anti-ABL1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABL1. |
Rabbit polyclonal Chk2 (Thr387) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 387 (C-G-TP-P-T). |
Modifications | Phospho-specific |
Anti-ABL1/ABL2 (phospho-Tyr393/429) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 393/429 (D-T-Y(p)-T-A) derived from Human ABL1/2. |
Modifications | Phospho-specific |
Anti-CDK6 (phospho-Tyr24) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 24 (G-A-Y(p)-G-K) derived from Human CDK6. |
Modifications | Phospho-specific |
Rabbit polyclonal Phospho-CDK7(T170) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK7 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T170 of human CDK7. |
Modifications | Phospho-specific |
Rabbit polyclonal Bi-Phospho-GSK3B(S21/29) Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GSK3B Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S21/29 of human GSK3B. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Rabbit Polyclonal ATM Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A fragment of the human ATM protein corresponding to the C-terminus (within the last third of the protein sequence). [UniProt# Q13315] |
PLK1 (C-term) Receptor Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PLK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 573-603 amino acids from the C-terminal region of human PLK1. |
Rabbit Polyclonal Antibody against BUB1B (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This BUBR1 (BUB1B) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 3-33 amino acids from the N-terminal region of human BUBR1 (BUB1B). |
Rabbit Polyclonal Antibody against CDC2 (T14)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Rabbit polyclonal Chk2 (Thr68) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of Threonine 68 (V-S-TP-Q-E). |
Modifications | Phospho-specific |
Rabbit polyclonal Chk2 (Ab-68) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 68. |
Rabbit polyclonal GSK3beta (Ab-9) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GSK3β |
Rabbit polyclonal anti-CDK7 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CDK7. |
Rabbit polyclonal Plk1 phospho T210 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-Polo-like Kinase pT210 Antibody was produced by repeated immunizations with a synthetic phospho peptide corresponding to aa 205-214 of Human Polo-like kinase 1 (Plk1) protein. |
Rabbit polyclonal GSK3 Beta phospho S9 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the aa 4-12 of human GSK3 beta. |
Rabbit polyclonal anti-cdk2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Anti-cdk2 antbody was prepared from whole rabbit serum by repeated immunizations with a synthetic peptide corresponding to the C-terminus of the human cdk-2 protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.22~26 (G-A-Y-G-K) derived from Human CDK6. |
Rabbit Polyclonal Anti-CDK7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Rabbit Polyclonal Anti-CDK7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Mouse Monoclonal Chk2 Antibody (73C175.1.1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal PLK1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 100-200 of human PLK1 was used as the immunogen. |
Mouse anti c-Abl Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit anti CDC2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of CDC2 protein from human, rat and mouse origins |
Rabbit anti-ATM (Phospho-Ser1981) polyclonal antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanATM around the phosphorylation site of serine 1981 (E-G-SP-Q-S). |
Modifications | Phospho-specific |
Rabbit polyclonal MYT1 (Ser83) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MYT1 around the phosphorylation site of serine 83 (R-V-SP-F-R). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-BUB1 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BUB1. |
Rabbit polyclonal ATR (Ser428) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ATR around the phosphorylation site of serine 428 (G-I-SP-P-K). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC7 Antibody (Kinase Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CDC7 antibody was raised against synthetic 19 amino acid peptide from kinase domain of human CDC7. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (95%). |
Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CHEK2 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |