Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
COX7A2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50). |
SDHA (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of Human SDHA |
Rabbit Polyclonal antibody to NDUFS8 (NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 210 of NDUFS8 (Uniprot ID#O00217) |
Rabbit Polyclonal antibody to NDUFS2 (NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 200 and 430 of NDUFS2 (Uniprot ID#O75306) |
Rabbit Polyclonal antibody to COX6B1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 23 and 86 of COX6B1 (Uniprot ID#P14854) |
Rabbit Polyclonal antibody to NDUFB5 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 126 and 189 of NDUFB5 (Uniprot ID#O43674) |
Rabbit Polyclonal antibody to NDUFS1 (NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 432 and 664 of NDUFS1 (Uniprot ID#P28331) |
Rabbit Polyclonal antibody to NDUFA10 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 43 and 355 of NDUFA10 (Uniprot ID#O95299) |
Rabbit Polyclonal antibody to NDUFA10 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 115 and 355 of NDUFA10 (Uniprot ID#O95299) |
Rabbit Polyclonal antibody to NDUFS4 (NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 175 of NDUFS4 (Uniprot ID#O43181) |
Active filters
Filter by
Target Symbol
- ATP5F1B (41)
- NDUFB10 (26)
- SDHB (20)
- NDUFB9 (18)
- ATP6V1C2 (15)
- COX17 (13)
- NDUFS2 (13)
- ATP6V1B1 (12)
- ATP5ME (10)
- ATP6V1F (10)
- COX6C (10)
- NDUFA4L2 (10)
- COX4I1 (8)
- ATP5F1C (7)
- ATP6V1B2 (6)
- NDUFA2 (6)
- NDUFA7 (6)
- UQCRC1 (6)
- UQCRFS1 (6)
- ATP5PO (5)
- ATP6V0D2 (5)
- PPA2 (5)
- ATP5PF (4)
- COX6B1 (4)
- NDUFA10 (4)
- NDUFA8 (3)
- NDUFS1 (3)
- NDUFS4 (3)
- NDUFS8 (3)
- SDHA (3)
- ATP5F1A (2)
- ATP5F1D (2)
- ATP6V1A (2)
- COX10 (2)
- COX5A (2)
- COX5B (2)
- COX7B (2)
- COX7B2 (2)
- NDUFA5 (2)
- NDUFA9 (2)
- NDUFAB1 (2)
- NDUFC2 (2)
- NDUFS5 (2)
- NDUFS6 (2)
- NDUFV2 (2)
- SDHD (2)
- ATP5E (1)
- ATP5MC2 (1)
- ATP5MC3 (1)
- ATP5MF (1)
- ATP5PD (1)
- ATP6V0A2 (1)
- ATP6V0B (1)
- ATP6V1D (1)
- ATP6V1H (1)
- COX11 (1)
- COX15 (1)
- COX6A1 (1)
- COX6A2 (1)
- COX6B2 (1)
- COX7A2 (1)
- COX7A2L (1)
- COX8A (1)
- LCMT2 (1)
- MTND1 (1)
- NDUFA1 (1)
- NDUFA11 (1)
- NDUFA3 (1)
- NDUFA4 (1)
- NDUFB1 (1)
- NDUFB5 (1)
- NDUFS3 (1)
- NDUFS7 (1)
- NDUFV1 (1)
- NDUFV3 (1)
- PPA1 (1)
- UQCR10 (1)
- UQCRB (1)
- UQCRC2 (1)