Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-CPE Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Cholecystokinin (CCK) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 21-70 of Human CCK. |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
USD 380.00
In Stock
Rabbit Polyclonal Anti-MGP
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGP antibody: synthetic peptide directed towards the middle region of human MGP. Synthetic peptide located within the following region: INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM |
Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Rat |
| Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Families
- Secreted Protein
Filter by
Target Symbol
- EGFR (23)
- GCG (11)
- AGR2 (10)
- LTF (10)
- ACE2 (9)
- BDNF (9)
- CXCL12 (9)
- TAC1 (9)
- LEP (8)
- LOX (8)
- MUC1 (8)
- TNF (8)
- AFP (7)
- ERBB3 (7)
- F13A1 (7)
- GNAS (7)
- MMP1 (7)
- SPP1 (7)
- TNFSF13 (7)
- ADAMTS5 (6)
- AGER (6)
- AGT (6)
- CALR (6)
- CLU (6)
- DEFA1 (6)
- FASLG (6)
- FGFR2 (6)
- GDF15 (6)
- HP (6)
- IGF1 (6)
- IL6 (6)
- NPY (6)
- NRG1 (6)
- SERPINB5 (6)
- SERPINE1 (6)
- SFRP1 (6)
- TNFRSF1A (6)
- TTR (6)
- VEGFA (6)
- WNT10B (6)
- WNT2B (6)
- ADAMTS1 (5)
- ADM (5)
- AGR3 (5)
- ATRN (5)
- B2M (5)
- CCL2 (5)
- CHGA (5)
- DPP4 (5)
- EDN1 (5)
- ERAP1 (5)
- FGF2 (5)
- GABBR1 (5)
- GSN (5)
- IL17A (5)
- IL23A (5)
- INS (5)
- KL (5)
- LHB (5)
- NGF (5)
- PIGR (5)
- RETNLB (5)
- SERPINC1 (5)
- SHH (5)
- SRPX2 (5)
- STX1A (5)
- SYT1 (5)
- TFRC (5)
- TNFRSF11B (5)
- VGF (5)
- WNT1 (5)
- WNT10A (5)
- ADAMTS4 (4)
- ADIPOQ (4)
- AMH (4)
- ANGPT1 (4)
- ANGPT2 (4)
- ANGPTL4 (4)
- APOA1 (4)
- APOH (4)
- BMP3 (4)
- CALCA (4)
- CRLF2 (4)
- CSF2 (4)
- DCN (4)
- DKK1 (4)
- EDA (4)
- EIF2AK3 (4)
- F9 (4)
- FGA (4)
- FGF1 (4)
- FGF4 (4)
- FGF7 (4)
- FLT1 (4)
- GAST (4)
- GH1 (4)
- GUCA2B (4)
- IFNB1 (4)
- IFNG (4)
- IL10 (4)
Reactivities
- Human (1205)
- Mouse (731)
- Rat (606)
- Bovine (45)
- Dog (38)
- Monkey (38)
- Pig (31)
- Rabbit (29)
- Horse (21)
- Gorilla (20)
- Gibbon (19)
- Bat (18)
- Hamster (15)
- Chicken (11)
- Mammalian (11)
- Primate (8)
- Cow (7)
- Xenopus (6)
- Porcine (5)
- Chimpanzee (4)
- Guinea Pig (4)
- Orang-Utan (4)
- Canine (3)
- Rhesus Monkey (3)
- Zebrafish (3)
- Equine (2)
- Feline (2)
- Opossum (2)
- Sheep (2)
- Amphibian (1)
- Birds (1)
- Goat (1)
- Macaque (1)
- Pufferfish (1)
Antibody Hosts
Conjugates
Modifications
Pathways
- Cytokine-cytokine receptor interaction (317)
- Pathways in cancer (212)
- MAPK signaling pathway (117)
- Jak-STAT signaling pathway (107)
- Complement and coagulation cascades (85)
- Focal adhesion (84)
- Hedgehog signaling pathway (82)
- Wnt signaling pathway (78)
- Melanogenesis (77)
- Basal cell carcinoma (74)
- Regulation of actin cytoskeleton (72)
- Chemokine signaling pathway (65)
- Hematopoietic cell lineage (60)
- TGF-beta signaling pathway (60)
- Melanoma (57)
- Toll-like receptor signaling pathway (56)
- Pancreatic cancer (51)
- Bladder cancer (48)
- Endocytosis (48)
- Prostate cancer (46)
- Allograft rejection (44)
- GnRH signaling pathway (44)
- Type I diabetes mellitus (44)
- Adipocytokine signaling pathway (42)
- ErbB signaling pathway (40)
- Neuroactive ligand-receptor interaction (39)
- Calcium signaling pathway (37)
- ECM-receptor interaction (37)
- Graft-versus-host disease (35)
- Apoptosis (34)
- NOD-like receptor signaling pathway (34)
- Natural killer cell mediated cytotoxicity (34)
- T cell receptor signaling pathway (34)
- Colorectal cancer (33)
- Autoimmune thyroid disease (32)
- Glioma (32)
- Hypertrophic cardiomyopathy (HCM) (32)
- Dilated cardiomyopathy (31)
- Metabolic pathways (31)
- Systemic lupus erythematosus (31)
- Gap junction (30)
- Epithelial cell signaling in Helicobacter pylori infection (29)
- Renal cell carcinoma (28)
- p53 signaling pathway (28)
- Alzheimer's disease (27)
- RIG-I-like receptor signaling pathway (27)
- Non-small cell lung cancer (26)
- PPAR signaling pathway (26)
- mTOR signaling pathway (26)
- Asthma (25)
- Cytosolic DNA-sensing pathway (25)
- Neurotrophin signaling pathway (25)
- Adherens junction (23)
- Dorso-ventral axis formation (23)
- Endometrial cancer (23)
- Prion diseases (23)
- Renin-angiotensin system (23)
- Axon guidance (22)
- Antigen processing and presentation (21)
- Fc epsilon RI signaling pathway (21)
- Long-term depression (19)
- Amyotrophic lateral sclerosis (ALS) (18)
- Type II diabetes mellitus (17)
- Cell cycle (14)
- Small cell lung cancer (14)
- Regulation of autophagy (13)
- Oocyte meiosis (11)
- Progesterone-mediated oocyte maturation (11)
- Chronic myeloid leukemia (10)
- Vascular smooth muscle contraction (10)
- Fc gamma R-mediated phagocytosis (9)
- Huntington's disease (9)
- Leukocyte transendothelial migration (9)
- Primary immunodeficiency (9)
- VEGF signaling pathway (9)
- Cell adhesion molecules (CAMs) (8)
- Maturity onset diabetes of the young (7)
- SNARE interactions in vesicular transport (7)
- Taste transduction (7)
- Vibrio cholerae infection (7)
- Arachidonic acid metabolism (6)
- Ether lipid metabolism (5)
- Glycerolipid metabolism (5)
- Insulin signaling pathway (5)
- Histidine metabolism (4)
- Proteasome (4)
- Viral myocarditis (4)
- Acute myeloid leukemia (3)
- Glutathione metabolism (3)
- Glycerophospholipid metabolism (3)
- Glycosphingolipid biosynthesis - lacto and neolacto series (3)
- Linoleic acid metabolism (3)
- O-Glycan biosynthesis (3)
- Pathogenic Escherichia coli infection (3)
- Starch and sucrose metabolism (3)
- Tyrosine metabolism (3)
- alpha-Linolenic acid metabolism (3)
- Arginine and proline metabolism (2)
- Folate biosynthesis (2)
- Glycosaminoglycan degradation (2)
- N-Glycan biosynthesis (2)
- Nitrogen metabolism (2)
- Riboflavin metabolism (2)
- Tryptophan metabolism (2)
- beta-Alanine metabolism (2)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Keratan sulfate biosynthesis (1)
- Lysosome (1)
- Other glycan degradation (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)