Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against CDH3 (C-term)
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDH3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 660-688 amino acids from the C-terminal region of human CDH3. |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit Polyclonal Anti-CLDN11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH |
Rabbit Polyclonal Anti-CD276 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CD276 antibody was raised against a peptide corresponding to 19 amino acids near the carboxy terminus of CD276. The immunogen is located within amino acids 484 - 534 of CD276. |
Rabbit Polyclonal Integrin alpha M/CD11b Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555] |
Rabbit anti-CD99 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD99 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-PVRL2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVRL2 |
Rabbit Polyclonal Anti-CLDN23 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
ICOSL / B7-H2 Mouse Monoclonal (2D3) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal SELL Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SELL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 346-372 amino acids from the C-terminal region of human SELL. |
Active filters
Reactivities
- Human
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Cell adhesion molecules (CAMs)
Filter by
Category
Target Symbol
- PECAM1 (71)
- CD99 (50)
- CD4 (49)
- PTPRC (47)
- PDCD1 (40)
- NCAM1 (39)
- CDH1 (33)
- L1CAM (28)
- PDCD1LG2 (28)
- CD40 (26)
- CD80 (23)
- CD2 (22)
- CD274 (19)
- CD34 (18)
- CD22 (16)
- VCAM1 (15)
- CD8A (14)
- SDC1 (13)
- CDH2 (11)
- ICOSLG (11)
- CDH4 (10)
- ITGAM (10)
- CTLA4 (9)
- NECTIN1 (8)
- SPN (8)
- CDH3 (7)
- CDH5 (7)
- ICAM3 (7)
- CD276 (6)
- CLDN3 (6)
- ICAM1 (6)
- CLDN1 (5)
- F11R (5)
- SMURF2 (5)
- CLDN5 (4)
- CLDN7 (4)
- ITGB1 (4)
- CADM3 (3)
- CLDN10 (3)
- CLDN4 (3)
- CNTNAP2 (3)
- GLG1 (3)
- HLA-DRB5 (3)
- ITGA6 (3)
- MADCAM1 (3)
- NEGR1 (3)
- PTPRM (3)
- ALCAM (2)
- CLDN11 (2)
- CLDN19 (2)
- CLDN23 (2)
- CLDN8 (2)
- CNTN1 (2)
- HLA-DMB (2)
- HLA-DPB1 (2)
- ITGAL (2)
- ITGB2 (2)
- MPZ (2)
- NECTIN2 (2)
- PVR (2)
- SELE (2)
- SELL (2)
- CD226 (1)
- CD6 (1)
- CD86 (1)
- CDH15 (1)
- CLDN17 (1)
- CLDN2 (1)
- CLDN6 (1)
- CNTNAP1 (1)
- HLA-A (1)
- HLA-B (1)
- HLA-F (1)
- HLA-G (1)
- ICAM2 (1)
- ICOS (1)
- ITGA4 (1)
- ITGAV (1)
- ITGB7 (1)
- JAM2 (1)
- MAG (1)
- NECTIN3 (1)
- NFASC (1)
- NLGN1 (1)
- NRCAM (1)
- SDC4 (1)
- SELPLG (1)
- VCAN (1)