Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
USD 380.00
In Stock
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
IL-17 Mouse Monoclonal (aa1-75) (4K5F6) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 515.00
In Stock
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Category
Target Symbol
- KIT (33)
- EGFR (31)
- TNFRSF8 (27)
- CD40 (26)
- HGF (15)
- MET (15)
- IL1A (14)
- CSF2 (13)
- CSF2RB (13)
- TNF (13)
- TNFRSF10B (13)
- CSF1 (11)
- CSF3 (11)
- CXCR4 (10)
- IL20 (9)
- IL24 (9)
- PDGFRA (9)
- PRL (9)
- IL2 (8)
- KDR (8)
- KITLG (8)
- VEGFB (8)
- ACVR2A (7)
- PDGFRB (7)
- TNFRSF18 (7)
- VEGFA (7)
- CCL19 (6)
- CCL2 (6)
- CSF1R (6)
- EGF (6)
- EPOR (6)
- IFNLR1 (6)
- LEP (6)
- NGFR (6)
- TGFBR2 (6)
- TNFRSF4 (6)
- CD70 (5)
- CRLF2 (5)
- CX3CR1 (5)
- IL10RA (5)
- IL12A (5)
- IL1B (5)
- IL6 (5)
- OSM (5)
- TNFRSF11B (5)
- TNFSF13 (5)
- CCR1 (4)
- CXCL12 (4)
- CXCR2 (4)
- CXCR3 (4)
- EDA (4)
- FASLG (4)
- GH2 (4)
- IFNGR2 (4)
- IL12B (4)
- IL17A (4)
- IL23R (4)
- IL6R (4)
- PDGFB (4)
- TGFB1 (4)
- TNFSF11 (4)
- TNFSF14 (4)
- VEGFC (4)
- VEGFD (4)
- ACVR1B (3)
- AMH (3)
- CCL1 (3)
- CCL17 (3)
- CCR3 (3)
- CCR6 (3)
- CCR7 (3)
- CCR8 (3)
- CX3CL1 (3)
- CXCR5 (3)
- FLT1 (3)
- FLT3 (3)
- IFNG (3)
- IL17B (3)
- IL17RA (3)
- IL18R1 (3)
- IL1R1 (3)
- IL23A (3)
- IL3 (3)
- INHBA (3)
- PDGFA (3)
- TGFB3 (3)
- TGFBR1 (3)
- TNFRSF1A (3)
- TNFSF10 (3)
- TSLP (3)
- ACVR1 (2)
- BMP2 (2)
- BMP7 (2)
- BMPR2 (2)
- CCL15 (2)
- CCL20 (2)
- CCL21 (2)
- CCL5 (2)
- CCL7 (2)
- CCR4 (2)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (757)
- Transmembrane (523)
- Secreted Protein (404)
- ES Cell Differentiation/IPS (230)
- Protein Kinase (143)
- Adult stem cells (92)
- Stem cell - Pluripotency (60)
- GPCR (51)
- Embryonic stem cells (44)
- Stem cell relevant signaling - JAK/STAT signaling pathway (36)
- Cancer stem cells (35)
- Transcription Factors (22)
- Protease (15)
- Induced pluripotent stem cells (11)
- Stem cell relevant signaling - DSL/Notch pathway (5)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (4)