Germany
Japan
United Kingdom
China
Antibodies
View as table Download
IGF2R rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
GGA3 (702-713) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bat, Equine, Human, Monkey, Porcine, Rabbit |
| Immunogen | Synthetic peptide from (C-term) of human GGA3 |
Rabbit Polyclonal Anti-GUSB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF |
Rabbit Polyclonal Anti-HEXA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV |
Mouse anti Macrophage /CD68 Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Legumain Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence (a portion from 100aa-190aa) of human Legumain protein. This sequence is identical to mouse, human and rat. |
Goat Anti-ABCB9 / TAPL Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GHNEPVANGSHKA, from the C Terminus of the protein sequence according to NP_062570.1; NP_062571.1; NP_982269.1. |
Mouse Monoclonal CD63 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Napsin A Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal CD68/SR-D1 Antibody (KP1)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GM2A Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GM2A antibody was raised against synthetic 15 amino acid peptide from internal region of human GM2A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey, Marmoset (93%). |
Rabbit Polyclonal Anti-GM2A Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GM2A antibody was raised against synthetic 17 amino acid peptide from N-terminus of human GM2A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Rat, Bovine, Cat, Elephant, Pig (88%); Mouse, Hamster, Panda, Horse, Platypus (82%). |
Rabbit Polyclonal Anti-GM2A Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GM2A antibody was raised against synthetic 14 amino acid peptide from N-terminus of human GM2A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (86%). |
Rabbit Polyclonal Anti-GM2A Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GM2A antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GM2A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Marmoset, Mouse, Rat, Bovine, Hamster, Elephant, Horse (81%). |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDS mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Active filters
Applications
- IHC
Families
- Druggable Genome
Pathways
- Lysosome
Filter by
Category
Target Symbol
- CD68 (58)
- CTSL (52)
- NAPSA (47)
- CD63 (43)
- GBA (31)
- GLB1 (17)
- IDS (15)
- NEU1 (11)
- PPT1 (10)
- CTSD (6)
- IGF2R (6)
- CTSK (5)
- NAGA (5)
- SMPD1 (5)
- CTSB (4)
- CTSE (4)
- GM2A (4)
- SCARB2 (4)
- ABCB9 (3)
- ASAH1 (3)
- GUSB (3)
- LAMP2 (3)
- NPC1 (3)
- PSAP (3)
- SORT1 (3)
- ACP2 (2)
- AP3S1 (2)
- ARSA (2)
- ARSB (2)
- CTSV (2)
- CTSZ (2)
- DNASE2 (2)
- GAA (2)
- GALNS (2)
- ABCA2 (1)
- ACP5 (1)
- AGA (1)
- ARSG (1)
- CTSC (1)
- CTSG (1)
- CTSH (1)
- CTSO (1)
- CTSS (1)
- FUCA1 (1)
- GALC (1)
- GGA3 (1)
- GLA (1)
- GNS (1)
- HEXA (1)
- HEXB (1)
- LGMN (1)
- LIPA (1)
- SGSH (1)