Germany
Japan
United Kingdom
China
Antibodies
Download
TTR / Transthyretin Mouse Monoclonal (10E1) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-NES Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NES antibody: synthetic peptide directed towards the middle region of human NES. Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-BTBD14B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the C terminal of human BTBD14B. Synthetic peptide located within the following region: WMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAE |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal KLF6 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 159-186 amino acids from the C-terminal region of human KLF6. |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
USD 515.00
In Stock
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- IHC
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- MKI67 (138)
- PECAM1 (105)
- ABCB1 (87)
- CD4 (79)
- CTNNB1 (71)
- JUN (66)
- AKT1 (65)
- PTPRC (63)
- BCL2 (58)
- NCAM1 (57)
- BSG (54)
- PIK3CG (54)
- EPCAM (53)
- KIT (51)
- PROCR (51)
- CDH1 (49)
- KRT7 (47)
- CD44 (46)
- FCGR2A (46)
- L1CAM (42)
- TNFRSF8 (41)
- GLI1 (40)
- EGFR (39)
- ID3 (36)
- NKX2-1 (35)
- GFAP (33)
- SERPINA1 (33)
- STAT5A (33)
- ENPEP (32)
- VIM (32)
- NEUROG1 (31)
- TNNI3 (31)
- CD34 (30)
- CD14 (28)
- MAPK9 (27)
- SMAD1 (25)
- GATA3 (24)
- HES1 (24)
- HGF (23)
- MCAM (23)
- VCAM1 (23)
- NOTCH1 (22)
- ANPEP (21)
- CSF2 (21)
- LHX1 (21)
- SDC1 (21)
- CASP3 (20)
- CDX2 (20)
- GAPDH (20)
- FGF21 (19)
- FN1 (19)
- CD8A (18)
- NES (18)
- CDCP1 (17)
- CSF1 (17)
- CSF3 (17)
- DVL2 (17)
- IRF6 (17)
- BCL2L1 (16)
- MPI (16)
- CDH2 (15)
- CPA1 (15)
- PDGFRA (15)
- IGF1 (14)
- ITGAM (14)
- ITGB3 (13)
- MAPK8 (13)
- PDX1 (13)
- YBX1 (13)
- ID2 (12)
- KLF5 (12)
- NECTIN1 (12)
- SOX9 (12)
- SPN (12)
- TRIM33 (12)
- ACE (11)
- CD38 (11)
- GLI2 (11)
- AKT2 (10)
- CXCR4 (10)
- AKT3 (9)
- BDNF (9)
- CDH5 (9)
- FOXA2 (9)
- GCG (9)
- ICAM3 (9)
- JAG1 (9)
- NEUROG3 (9)
- PDGFRB (9)
- SOX2 (9)
- ACTN1 (8)
- ANGPT1 (8)
- EGF (8)
- HNF4A (8)
- KDR (8)
- LAMP1 (8)
- SMAD3 (8)
- STAT5B (8)
- TTR (8)
- ALDH1A1 (7)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (883)
- Cell adhesion molecules (CAMs) (587)
- Focal adhesion (572)
- Colorectal cancer (509)
- T cell receptor signaling pathway (420)
- Hematopoietic cell lineage (395)
- Prostate cancer (371)
- MAPK signaling pathway (365)
- ErbB signaling pathway (352)
- Melanoma (331)
- Leukocyte transendothelial migration (328)
- Endometrial cancer (325)
- Neurotrophin signaling pathway (318)
- Cytokine-cytokine receptor interaction (310)
- Toll-like receptor signaling pathway (279)
- Jak-STAT signaling pathway (266)
- Regulation of actin cytoskeleton (266)
- Fc gamma R-mediated phagocytosis (264)
- Pancreatic cancer (262)
- Wnt signaling pathway (261)
- Acute myeloid leukemia (258)
- Small cell lung cancer (244)
- Renal cell carcinoma (243)
- Glioma (236)
- Apoptosis (234)
- Adherens junction (219)
- B cell receptor signaling pathway (217)
- Chronic myeloid leukemia (216)
- Fc epsilon RI signaling pathway (212)
- Progesterone-mediated oocyte maturation (202)
- Non-small cell lung cancer (198)
- Insulin signaling pathway (196)
- Basal cell carcinoma (191)
- Melanogenesis (184)
- Tight junction (184)
- Epithelial cell signaling in Helicobacter pylori infection (171)
- Chemokine signaling pathway (169)
- Pathogenic Escherichia coli infection (166)
- GnRH signaling pathway (165)
- VEGF signaling pathway (165)
- mTOR signaling pathway (162)
- Primary immunodeficiency (160)
- Endocytosis (156)
- Adipocytokine signaling pathway (137)
- Thyroid cancer (135)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (132)
- Natural killer cell mediated cytotoxicity (123)
- Type II diabetes mellitus (120)
- TGF-beta signaling pathway (118)
- ECM-receptor interaction (116)
- Antigen processing and presentation (105)
- Bladder cancer (103)
- Amyotrophic lateral sclerosis (ALS) (100)
- Metabolic pathways (98)
- Hedgehog signaling pathway (97)
- Gap junction (93)
- Hypertrophic cardiomyopathy (HCM) (90)
- ABC transporters (89)
- Prion diseases (89)
- Maturity onset diabetes of the young (85)
- Notch signaling pathway (82)
- Calcium signaling pathway (80)
- Dilated cardiomyopathy (79)
- Dorso-ventral axis formation (68)
- Axon guidance (67)
- Renin-angiotensin system (64)
- Phosphatidylinositol signaling system (60)
- Systemic lupus erythematosus (59)
- Inositol phosphate metabolism (54)
- Alzheimer's disease (51)
- NOD-like receptor signaling pathway (47)
- RIG-I-like receptor signaling pathway (43)
- Viral myocarditis (41)
- Complement and coagulation cascades (40)
- p53 signaling pathway (36)
- Cardiac muscle contraction (31)
- Huntington's disease (31)
- Glycolysis / Gluconeogenesis (28)
- Long-term depression (27)
- Oocyte meiosis (24)
- Glutathione metabolism (21)
- Parkinson's disease (20)
- Nicotinate and nicotinamide metabolism (18)
- Amino sugar and nucleotide sugar metabolism (16)
- Fructose and mannose metabolism (16)
- Cell cycle (14)
- Autoimmune thyroid disease (13)
- Long-term potentiation (13)
- Vascular smooth muscle contraction (13)
- Type I diabetes mellitus (12)
- Vibrio cholerae infection (12)
- Lysosome (11)
- Retinol metabolism (11)
- Allograft rejection (10)
- Neuroactive ligand-receptor interaction (10)
- Graft-versus-host disease (9)
- Galactose metabolism (7)
- Purine metabolism (7)
- Pyrimidine metabolism (7)
- Starch and sucrose metabolism (7)
- Ubiquitin mediated proteolysis (7)
- Drug metabolism - cytochrome P450 (4)
- Drug metabolism - other enzymes (4)
- Linoleic acid metabolism (4)
- Metabolism of xenobiotics by cytochrome P450 (4)
- Regulation of autophagy (3)
- Tyrosine metabolism (3)
- PPAR signaling pathway (2)
- Asthma (1)
- Citrate cycle (TCA cycle) (1)
- Cysteine and methionine metabolism (1)
- Oxidative phosphorylation (1)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Primary bile acid biosynthesis (1)
- Pyruvate metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)