Anti-LGR5 mouse mAb, clone OTI2A2, PE conjugated
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | PE |
Anti-LGR5 mouse mAb, clone OTI2A2, PE conjugated
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | PE |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
Conjugation | Unconjugated |
Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit anti-CXCR3 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CXCR3 |
USD 440.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
Applications | FC, IHC, WB |
Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
Rabbit Polyclonal Anti-P2Y1 Receptor (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide SDEYLRSYFIYSMC, corresponding to amino acid residues 207-220 of human P2Y1 Receptor. 2nd extracellular loop. |
Rabbit Polyclonal Anti-NPY1R Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
Rabbit Polyclonal Anti-APLNR Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APLNR |
Rabbit Polyclonal Anti-CHRM1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRM1 |
USD 655.00
2 Weeks
Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, WB |
Reactivities | Rat |
Immunogen | D2s (Ac239-Cys247) covalently attached to a carrier protein |
Rabbit Polyclonal Anti-ADORA2B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal S1P1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
Rabbit Polyclonal Anti-CASR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CASR antibody was raised against a 15 amino acid peptide near the amino terminus of human CASR. |
Rabbit Polyclonal Anti-TRIP12 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRIP12 antibody was raised against a 18 amino acid peptide near the carboxy terminus of human TRIP12. |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Encephalopsin (OPN3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to amino acids 176-220 of Human Encephalopsin. |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Chimpanzee, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%). |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6 |
Rabbit Polyclonal CX3CR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
Mu Opioid Receptor (OPRM1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Immunogen | KLH conjugated synthetic peptide between 161-187 amino acids from the Center region of human OPRM1 |
5 HT 2A (HTR2A) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal CXCR4 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal AGTR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Chimpanzee, Gorilla, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
Rabbit anti-SIGMAR1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit Polyclonal CCR1 Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody was raised against a synthetic peptide of human CCR1 protein. |
Rabbit Polyclonal Anti-FZD9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit Polyclonal MAS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human MAS1 protein (between residues 75-125) [UniProt P04201] |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Human, Gorilla |
Conjugation | Unconjugated |
Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
GPR65 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | GPR65 / TDAG8 antibody was raised against synthetic 18 amino acid peptide from 3rd extracellular domain of human GPR65. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon (94%). |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
Rabbit Polyclonal GLP-1R Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human GLP1R protein (between residues 250-350) [UniProt P43220] |
ACKR3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 330-358 amino acids from the C-terminal region of Human CXCR7. |
Rabbit Polyclonal CCR3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CCR3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human CCR3. |
Rabbit Polyclonal GPR3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPR3 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human GPR3. |
Rabbit Polyclonal MC4R Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MC4R antibody was raised against a 19 amino acid peptide near the amino terminus of human MC4R. |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-Melanocortin Receptor 4 (extracellular)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)HRGMHTSLHLWNRSS, corresponding to amino acid residues 6-20 of human MC4R. Extracellular, N terminal. |
Rabbit Polyclonal Anti-P2Y12 Receptor
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KTTRPFKTSNPKNLLGAK,corresponding to amino acid residues 125-142 of human P2Y12 receptor.Intracellular, 2nd Cytoplasmic loop. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from 3rd extracellular domain of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Rabbit, Guinea pig (85%); Bovine, Elephant, Horse, Pig (80%). |
Rabbit Polyclonal Anti-FZD4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Rabbit Polyclonal Anti-GPR6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR6 antibody: synthetic peptide directed towards the N terminal of human GPR6. Synthetic peptide located within the following region: NASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGAN |