Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 67 results

Page 1 of 2

(reset)

NGF Rabbit Polyclonal Antibody

TA349414

USD 380.00

In Stock

Rabbit Polyclonal Anti-NGF Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human NGF

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

1 / 2

2 / 2

Previous Next

IL1 beta (IL1B) Rabbit Polyclonal Antibody

TA336742

USD 424.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]

1 / 2

2 / 2

Previous Next

IL1 alpha (IL1A) Rabbit Polyclonal Antibody

TA349352

USD 380.00

In Stock

Rabbit Polyclonal Anti-IL1A Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human IL1A

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TNFRSF1A Rabbit Polyclonal Antibody

TA327070

USD 275.00

3 Weeks

Rabbit anti-TNF-R1 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Mouse, Human, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human TNF-R1

1 / 3

2 / 3

3 / 3

Previous Next

IL1 beta (IL1B) Rabbit Polyclonal Antibody

AP20628PU-N

USD 370.00

2 Weeks

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA313322

USD 345.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human TNFA.

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) (1-234) Mouse Monoclonal Antibody [Clone ID: M1-C4]

AM31768PU-N

USD 480.00

2 Weeks

TNF alpha (TNF) (1-234) mouse monoclonal antibody, clone M1-C4, Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Rat

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NGF Rabbit Polyclonal Antibody

AP23284PU-N

USD 405.00

2 Weeks

NGF rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Peptide mapping human NGF beta

1 / 2

2 / 2

Previous Next

TNFRSF1A (N-term) Rabbit Polyclonal Antibody

AP54311PU-N

USD 450.00

2 Weeks

TNFRSF1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human TNFRSF1A

1 / 3

2 / 3

3 / 3

Previous Next

CD95 (FAS) Rabbit Polyclonal Antibody

TA313381

USD 345.00

In Stock

Rabbit polyclonal anti-FAS antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.

1 / 2

2 / 2

Previous Next

Fas Ligand (FASLG) Rabbit Polyclonal Antibody

TA313465

USD 345.00

In Stock

Rabbit polyclonal FAS ligand antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human FAS ligand.

1 / 3

2 / 3

3 / 3

Previous Next

Fas Ligand (FASLG) Rabbit Polyclonal Antibody

TA590045

USD 409.00

In Stock

Rabbit Polyclonal Fas Ligand Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody was made against a protein fragment from the C Terminus Region

1 / 2

2 / 2

Previous Next

TNFRSF1A (195-211) Rabbit Polyclonal Antibody

AP23346PU-N

USD 405.00

2 Weeks

TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Goat, Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211).

1 / 2

2 / 2

Previous Next

TNFRSF1A (20-43) Rabbit Polyclonal Antibody

AP33393PU-N

USD 440.00

2 Weeks

TNFRSF1A (20-43) rabbit polyclonal antibody, Purified

Applications	IHC, IP, WB
Reactivities	Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat
Immunogen	TNFRSF1A antibody was raised against a synthetic peptide based on residues 20-43 of Mouse TNF-R1.

TNFRSF1A Rabbit Polyclonal Antibody

TA311833

USD 345.00

In Stock

Rabbit polyclonal TNF Receptor-1 antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1.

NGF Rabbit Polyclonal Antibody

TA328405

USD 285.00

5 Days

Anti-Human β-NGF Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human β-NGF

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Goat Polyclonal Antibody

TA328454

USD 285.00

5 Days

Anti-Human TNF-a Goat Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human TNF-α

1 / 2

2 / 2

Previous Next

CD95 (FAS) Rabbit Polyclonal Antibody

AP06448PU-N

USD 370.00

2 Weeks

CD95 (FAS) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide, corresponding to amino acids 280-330 of Human CD95.

1 / 2

2 / 2

Previous Next

NGF Rabbit Polyclonal Antibody

AP20675PU-N

USD 407.00

2 Weeks

NGF rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

Fas Ligand (FASLG) (N-term) Rabbit Polyclonal Antibody

AP22688PU-N

USD 440.00

2 Weeks

Fas Ligand (FASLG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	FASLG antibody was raised against peptide mapping near the amino terminus of rat FAS-L

Fas Ligand (FASLG) (C-term) Rabbit Polyclonal Antibody

AP23382PU-N

USD 405.00

2 Weeks

Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA319289

USD 1,380.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications	IHC, WB
Reactivities	Human, Primate
Conjugation	Unconjugated
Immunogen	The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA319290

USD 1,380.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

1 / 3

2 / 3

3 / 3

Previous Next

IL1 alpha (IL1A) Rabbit Polyclonal Antibody

TA328201

USD 285.00

5 Days

Anti-Human IL-1alpha Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human IL-1alpha

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA328455

USD 285.00

5 Days

Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human TNF-α

1 / 2

2 / 2

Previous Next

TNFRSF1A Rabbit Polyclonal Antibody

TA330321

USD 375.00

5 Days

Rabbit Polyclonal Anti-TNFRSF1A Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA336738

USD 479.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Fas Ligand (FASLG) Goat Polyclonal Antibody

TA328307

USD 285.00

5 Days

Anti-Human sFas Ligand Goat Polyclonal Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	CHO cell derived recombinant Human sFas Ligand.

IL3 Mouse Monoclonal Antibody [Clone ID: OTI3B11]

CF500182

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) IL-3 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

IL1 beta (IL1B) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

CF506443

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IL1B mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

CF506510

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

IL1 alpha (IL1A) Mouse Monoclonal Antibody [Clone ID: OTI2E7]

CF506848

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IL1A mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications	IF, IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

IL1 alpha (IL1A) Mouse Monoclonal Antibody [Clone ID: OTI2F8]

CF506849

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IL1A mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

IL1 alpha (IL1A) Mouse Monoclonal Antibody [Clone ID: OTI2F11]

CF506850

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) IL1A mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IL1 alpha (IL1A) Mouse Monoclonal Antibody [Clone ID: OTI3C3]

CF506853

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IL1A mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5H8]

CF807833

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IL1 beta (IL1B) Rabbit Polyclonal Antibody

TA321162

USD 345.00

In Stock

Anti-IL1B Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 3

2 / 3

3 / 3

Previous Next

NGF Rabbit Polyclonal Antibody

TA321493

USD 345.00

4 Weeks

Anti-NGF Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 80-94 amino acids of human nerve growth factor (beta polypeptide)

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA323618

USD 345.00

In Stock

Anti-TNF Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CD95 (FAS) Rabbit Polyclonal Antibody

TA323754

USD 345.00

4 Weeks

Anti-FAS Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6)

1 / 3

2 / 3

3 / 3

Previous Next

IL1RAP Rabbit Polyclonal Antibody

TA324046

USD 335.00

4 Weeks

Anti-IL1RAP Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 22-356 amino acids of Human Interleukin-1 receptor accessory protein

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Fas Ligand (FASLG) Rabbit Polyclonal Antibody

TA350662

USD 345.00

In Stock

Rabbit Polyclonal Anti-FASLG Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human FASLG

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IL3 Mouse Monoclonal Antibody [Clone ID: OTI3B11]

TA500182

USD 379.00

In Stock

IL-3 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

IL3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B11]

TA500182AM

USD 420.00

4 Weeks

IL-3 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

IL3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]

TA500182BM

USD 420.00

4 Weeks

IL-3 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

IL3 Mouse Monoclonal Antibody [Clone ID: OTI3B11]

TA500182S

USD 159.00

In Stock

IL-3 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IL1 beta (IL1B) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

TA506443

USD 379.00

In Stock

IL1B mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IL1 beta (IL1B) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

TA506443S

USD 159.00

In Stock

IL1B mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

TA506510

USD 379.00

In Stock

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

1 - 50 of 67 results

Page 1 of 2