Germany
Japan
United Kingdom
China
FBXW7 / FBW7 Mouse Monoclonal (3D1) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal anti-TRIM32 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE |
PRP19 (PRPF19) (C-term) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic C-terminal peptide of human Prp19p protein (aa 182-192) conjugated to KLH |
SIAH1 (+SIAH2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
SOCS1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human SOCS1 |
HIP2 (UBE2K) (144-157) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Bovine, Canine, Chicken, Equine, Goat, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish |
| Immunogen | Synthetic peptide from C-terminus of human HIP2 (aa 144-157) |
UBC3B (UBE2R2) (N-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, EM, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the N Terminus of the protein sequence according to NP_060281. |
Rabbit polyclonal antibody to UBE4B (ubiquitination factor E4B (UFD2 homolog, yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 869 and 1179 of UBE4B (Uniprot ID#O95155) |
Rabbit Polyclonal antibody to SAE1 (SUMO1 activating enzyme subunit 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chimpanzee) |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 3 and 247 of SAE1 (Uniprot ID#Q9UBE0) |
Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal BRCA1 (Ab-1423) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human BRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit polyclonal CDC16/APC6 (Ser560) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-APC1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human APC1. |
UBE1L2 / FLJ10808 Mouse Monoclonal (1D11) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-Cbl-c antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 444-458 of Human Cbl-c. |
Rabbit polyclonal Ubiquitin Activating Enzyme E1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Ubiquitin Activating Enzyme E1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to full length Human Ubiquitin Activating Enzyme E1. |
Active filters
Applications
- IHC
Pathways
- Ubiquitin mediated proteolysis
Filter by
Category
Target Symbol
- UBE2G2 (50)
- MDM2 (48)
- UBE2J1 (30)
- FBXW7 (28)
- SOCS3 (27)
- ANAPC11 (25)
- BRCA1 (24)
- SAE1 (23)
- UBE2E3 (20)
- ERCC8 (18)
- UBE2D2 (17)
- KEAP1 (12)
- UBOX5 (10)
- CUL4B (8)
- SMURF2 (8)
- UBA2 (7)
- VHL (7)
- ANAPC1 (6)
- ANAPC2 (6)
- CDC16 (6)
- PIAS1 (6)
- PIAS2 (6)
- UBA3 (6)
- UBA7 (6)
- BIRC6 (5)
- SIAH1 (5)
- TRAF6 (5)
- UBE2D4 (5)
- UBE3B (5)
- BIRC2 (4)
- CDC27 (4)
- CUL1 (4)
- CUL3 (4)
- CUL4A (4)
- PIAS3 (4)
- PRKN (4)
- SOCS1 (4)
- STUB1 (4)
- UBE2L3 (4)
- UBE2S (4)
- UBR5 (4)
- XIAP (4)
- AIRE (3)
- ANAPC10 (3)
- ANAPC4 (3)
- ANAPC5 (3)
- CBL (3)
- CDC20 (3)
- CUL2 (3)
- CUL7 (3)
- DDB1 (3)
- PML (3)
- SKP1 (3)
- SKP2 (3)
- SMURF1 (3)
- TRIM32 (3)
- UBA1 (3)
- UBE2N (3)
- ANAPC7 (2)
- BIRC3 (2)
- CUL5 (2)
- PIAS4 (2)
- PRPF19 (2)
- SYVN1 (2)
- ANAPC13 (1)
- BTRC (1)
- CBLC (1)
- CDC23 (1)
- CDC34 (1)
- ELOB (1)
- ELOC (1)
- FANCL (1)
- FBXO2 (1)
- FBXW11 (1)
- FBXW8 (1)
- FZR1 (1)
- ITCH (1)
- KLHL13 (1)
- MAP3K1 (1)
- MID1 (1)
- NEDD4 (1)
- NEDD4L (1)
- RBX1 (1)
- RCHY1 (1)
- RHOBTB2 (1)
- RNF7 (1)
- TRIM37 (1)
- TTK (1)
- UBA6 (1)
- UBE2B (1)
- UBE2C (1)
- UBE2D1 (1)
- UBE2E1 (1)
- UBE2E2 (1)
- UBE2I (1)
- UBE2J2 (1)
- UBE2K (1)
- UBE2L6 (1)
- UBE2M (1)
- UBE2NL (1)