Germany
Japan
United Kingdom
China
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
Antibodies
View as table Download
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
| Applications | IF, IHC, IP, WB |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
Rabbit polyclonal TTK (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit anti-MMP7 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MMP7 |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit anti-PPARD Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPARD |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Rabbit Polyclonal Anti-CHP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Rabbit polyclonal Cyclin D3 (Thr283) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin D3 around the phosphorylation site of threonine 283 (T-S-TP-P-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal AXIN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AXIN2 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human AXIN2. The immunogen is located within amino acids 780 - 830 of AXIN2. |
Rabbit polyclonal JUN Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Rabbit polyclonal SMAD4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4. |
Rabbit polyclonal c-Jun (Phospho-Ser63) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of Serine 63. |
| Modifications | Phospho-specific |
SMAD3 mouse monoclonal antibody, clone AF9F7, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
c-Myc (MYC) mouse monoclonal antibody, clone IMD-3, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
p53 (TP53) mouse monoclonal antibody, clone B-P3, Azide Free
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
Active filters
Applications
- IHC
Pathways
- Wnt signaling pathway
Filter by
Category
Target Symbol
- TP53 (149)
- CTNNB1 (83)
- JUN (67)
- SENP2 (64)
- MYC (32)
- MAPK9 (28)
- MAPK8 (26)
- MMP7 (22)
- WNT3 (22)
- CHP1 (17)
- DVL2 (17)
- APC (15)
- CSNK1E (12)
- CTBP2 (12)
- SMAD3 (12)
- SOX17 (12)
- CAMK2B (10)
- PPARD (10)
- PPP2R5D (10)
- PPP3CA (10)
- SFRP2 (10)
- GSK3B (9)
- PRKCA (9)
- PPP2R1B (8)
- CCND1 (7)
- EP300 (7)
- FOSL1 (7)
- LEF1 (7)
- ROCK2 (7)
- CAMK2A (6)
- SFRP1 (6)
- SMAD2 (6)
- WNT10B (6)
- WNT2B (6)
- WNT3A (6)
- CREBBP (5)
- CTBP1 (5)
- NFATC4 (5)
- SIAH1 (5)
- WNT1 (5)
- WNT10A (5)
- CCND3 (4)
- CSNK1A1 (4)
- CSNK2A1 (4)
- CUL1 (4)
- DKK1 (4)
- FZD2 (4)
- FZD8 (4)
- MAP3K7 (4)
- NFATC1 (4)
- PLCB3 (4)
- PPP2R1A (4)
- ROCK1 (4)
- SMAD4 (4)
- WNT5B (4)
- AXIN1 (3)
- AXIN2 (3)
- FZD4 (3)
- FZD9 (3)
- LRP5 (3)
- LRP6 (3)
- PPP2CA (3)
- PSEN1 (3)
- SKP1 (3)
- WNT11 (3)
- WNT16 (3)
- WNT2 (3)
- WNT5A (3)
- WNT6 (3)
- WNT8A (3)
- WNT9A (3)
- WNT9B (3)
- APC2 (2)
- CCND2 (2)
- CXXC4 (2)
- FZD1 (2)
- FZD3 (2)
- FZD5 (2)
- FZD6 (2)
- NFATC2 (2)
- NFATC3 (2)
- NLK (2)
- PPP2CB (2)
- PPP3CC (2)
- PRKACA (2)
- PRKACG (2)
- PRKCB (2)
- PRKX (2)
- RAC1 (2)
- RHOA (2)
- TBL1X (2)
- TBL1XR1 (2)
- TCF7 (2)
- VANGL1 (2)
- WIF1 (2)
- WNT4 (2)
- WNT7A (2)
- WNT8B (2)
- BTRC (1)
- CAMK2G (1)
Reactivities
- Human (805)
- Mouse (603)
- Rat (551)
- Monkey (146)
- Dog (108)
- Bovine (31)
- Pig (19)
- Rabbit (16)
- Chicken (15)
- Gorilla (12)
- Hamster (12)
- Bat (11)
- Horse (11)
- Xenopus (11)
- Gibbon (10)
- Primate (6)
- Zebrafish (6)
- Cow (5)
- X. tropicalis (4)
- Canine (2)
- Guinea Pig (2)
- Chimpanzee (1)
- Fish (1)
- Opossum (1)
- Orang-Utan (1)
- Porcine (1)
- Rhesus Monkey (1)
- Sheep (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (847)
- Transcription Factors (438)
- ES Cell Differentiation/IPS (316)
- Stem cell - Pluripotency (201)
- Protein Kinase (140)
- Secreted Protein (111)
- Stem cell relevant signaling - Wnt Signaling pathway (95)
- Transmembrane (94)
- Protease (89)
- Cancer stem cells (59)
- Stem cell relevant signaling - JAK/STAT signaling pathway (57)
- Embryonic stem cells (50)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (50)
- Induced pluripotent stem cells (44)
- Adult stem cells (42)
- Phosphatase (41)
- GPCR (19)
- Nuclear Hormone Receptor (10)
- Stem cell relevant signaling - DSL/Notch pathway (7)