Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal RIPK2 (Ser176) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal FRS2 (Tyr436) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FRS2 around the phosphorylation site of tyrosine 436 (L-N-YP-I-Q). |
| Modifications | Phospho-specific |
Rabbit Polyclonal FRS2 (Tyr436) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human FRS2 around the phosphorylation site of Tyrosine 436. |
| Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit polyclonal RIPK2 (Ab-176) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Active filters
Reactivities
- Mouse
Applications
- IHC
Pathways
- Neurotrophin signaling pathway
Filter by
Target Symbol
- MAP2K1 (173)
- AKT1 (64)
- JUN (63)
- BCL2 (51)
- PIK3CG (51)
- PIK3R5 (36)
- MAPK1 (29)
- BRAF (28)
- TP73 (28)
- MAPK9 (27)
- PIK3CD (27)
- HRAS (26)
- IRS1 (22)
- PIK3CA (21)
- BAX (18)
- MAP2K2 (18)
- MAPK13 (16)
- NTF3 (16)
- TP53 (16)
- NTRK3 (15)
- RAPGEF1 (15)
- MAPK8 (13)
- SHC1 (13)
- NFKBIA (12)
- RELA (11)
- AKT2 (9)
- AKT3 (9)
- BAD (9)
- FOXO3 (9)
- NTRK1 (9)
- NTRK2 (9)
- CAMK2B (8)
- BDNF (7)
- MAPK3 (7)
- NTF4 (7)
- ARHGDIA (6)
- MAPK12 (6)
- MAPK14 (6)
- NRAS (6)
- GSK3B (5)
- RAF1 (5)
- RPS6KA1 (5)
- ABL1 (4)
- IRAK1 (4)
- MAPKAPK2 (4)
- NFKBIE (4)
- NGFR (4)
- PIK3R1 (4)
- PRKCD (4)
- TRAF6 (4)
- YWHAZ (4)
- CAMK2A (3)
- GRB2 (3)
- IKBKB (3)
- MAGED1 (3)
- NFKB1 (3)
- NFKBIB (3)
- PTPN11 (3)
- YWHAB (3)
- YWHAE (3)
- YWHAG (3)
- YWHAQ (3)
- BEX3 (2)
- CAMK4 (2)
- FRS2 (2)
- IRAK3 (2)
- IRS2 (2)
- MAP3K5 (2)
- MAPK7 (2)
- NGF (2)
- PLCG1 (2)
- PSEN1 (2)
- RAC1 (2)
- RAP1A (2)
- RAP1B (2)
- RIPK2 (2)
- RPS6KA2 (2)
- RPS6KA5 (2)
- SORT1 (2)
- ARHGDIB (1)
- ATF4 (1)
- CALM1 (1)
- CDC42 (1)
- CRK (1)
- CRKL (1)
- FASLG (1)
- GAB1 (1)
- IRAK4 (1)
- IRS4 (1)
- MAP2K5 (1)
- MAP2K7 (1)
- MAP3K1 (1)
- MAPK10 (1)
- PIK3CB (1)
- PIK3R2 (1)
- PIK3R3 (1)
- PLCG2 (1)
- RPS6KA3 (1)
- SHC3 (1)