Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal antibody to VAPA (VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 29 and 122 of VAPA (Uniprot ID#Q9P0L0) |
Rabbit Polyclonal antibody to VCP (valosin-containing protein)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072) |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal YOD1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This YOD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-347 amino acids from the C-terminal region of human YOD1. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
CALM1 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human calmodulin. |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Mouse Monoclonal anti-DLG4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against GNB2L1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GNB2L1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human GNB2L1. |
Rabbit Polyclonal Antibody against WIF1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This WIF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 51-80 amino acids from the N-terminal region of human WIF1. |
Rabbit polyclonal antibody to EML1 (echinoderm microtubule associated protein like 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 753 and 815 of EML1 (Uniprot ID#O00423) |
Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2) |
Mouse Monoclonal anti-slo1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
CLTC / Clathrin Heavy Chain Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | CLTC / Clathrin Heavy Chain antibody was raised against synthetic peptide C-ESLRKEEEQATETQ from an internal region (near C-terminus) of human CLTC (NP_004850.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (93%); Pufferfish (86%). |
UCP2 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Xenopus, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | UCP2 antibody was raised against synthetic peptide C-DSVKQFYTKGSEH from an internal region of human UCP2 (NP_003346.2). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Xenopus, Stickleback (100%); Smelt, Zebrafish (92%); Trout, Salmon (85%). |
SCG10 / STMN2 Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Dog, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | SCG10 / STMN2 antibody was raised against synthetic peptide AKTAMAYKEK-C from the N-terminus of human STMN2 (NP_008960.2). Percent identity by BLAST analysis: Human, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Turkey, Chicken (100%); Xenopus, Stickleback, Zebrafish (90%); Water flea, Poplar, Arabidopsis (80%). |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Rabbit polyclonal CAF-1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1. |
Rabbit polyclonal METTL2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This METTL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-359 amino acids from the C-terminal region of human METTL2. |
Rabbit polyclonal Mib1/Mindbomb Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Mib1/Mindbomb antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human Mib1/Mindbomb. |
Active filters
Reactivities
- Zebrafish
Applications
- IHC
Filter by
Category
Target Symbol
- KCNMA1 (3)
- DNMT1 (2)
- H2AFZ (2)
- HPRT1 (2)
- KCNAB2 (2)
- RHO (2)
- SMAD3 (2)
- AGR2 (1)
- ARAF (1)
- ATG5 (1)
- CALCRL (1)
- CASK (1)
- CCT8 (1)
- CDK5 (1)
- CLTC (1)
- CNOT7 (1)
- CS (1)
- CTNNB1 (1)
- DCT (1)
- DDX39A (1)
- DLG4 (1)
- DLST (1)
- DMC1 (1)
- DOCK1 (1)
- DUSP7 (1)
- EIF2B2 (1)
- EML1 (1)
- ESRRG (1)
- FBXO43 (1)
- FOSL2 (1)
- GALNT7 (1)
- GAPDH (1)
- GET3 (1)
- GIPC1 (1)
- GLG1 (1)
- GPR19 (1)
- GPR4 (1)
- GPRC5B (1)
- IDI1 (1)
- IPO7 (1)
- JMJD6 (1)
- KCNA2 (1)
- LIMCH1 (1)
- MAP1LC3A (1)
- MAPK14 (1)
- MCM7 (1)
- METTL2A (1)
- MIB1 (1)
- MLEC (1)
- MYC (1)
- NOLC1 (1)
- NPY (1)
- OPA1 (1)
- PCCB (1)
- PDE6D (1)
- PGD (1)
- PSMB8 (1)
- PSMC3 (1)
- PSMC6 (1)
- PTGES (1)
- PUF60 (1)
- RAB5A (1)
- RAB5B (1)
- RAB6A (1)
- RACK1 (1)
- RPL13A (1)
- SCN1A (1)
- SEC13 (1)
- SEC61A1 (1)
- SF3B3 (1)
- SLC31A1 (1)
- SNX12 (1)
- SOX17 (1)
- SOX2 (1)
- ST3GAL2 (1)
- STMN2 (1)
- SUCLA2 (1)
- SURF4 (1)
- TARDBP (1)
- TBCK (1)
- TBP (1)
- TM9SF3 (1)
- TMEM147 (1)
- TMEM33 (1)
- UAP1 (1)
- UCHL3 (1)
- UCP2 (1)
- VAPA (1)
- VCP (1)
- VPS11 (1)
- VPS26A (1)
- VPS35 (1)
- WIF1 (1)
- XPO7 (1)
- YOD1 (1)
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Families
- Druggable Genome (53)
- Transmembrane (21)
- Transcription Factors (14)
- ES Cell Differentiation/IPS (7)
- Cancer stem cells (4)
- Embryonic stem cells (4)
- GPCR (4)
- Ion Channels: Potassium (4)
- Protein Kinase (4)
- Stem cell - Pluripotency (4)
- Secreted Protein (3)
- Stem cell relevant signaling - JAK/STAT signaling pathway (3)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (3)
- Induced pluripotent stem cells (2)
- Protease (2)
- Stem cell relevant signaling - Wnt Signaling pathway (2)
- Adult stem cells (1)
- Nuclear Hormone Receptor (1)
- Phosphatase (1)
Pathways
- Metabolic pathways (15)
- Wnt signaling pathway (6)
- Colorectal cancer (5)
- Pathways in cancer (5)
- Vascular smooth muscle contraction (5)
- Cell cycle (4)
- Chronic myeloid leukemia (4)
- Adherens junction (3)
- Citrate cycle (TCA cycle) (3)
- Endocytosis (3)
- Endometrial cancer (3)
- Huntington's disease (3)
- MAPK signaling pathway (3)
- Pancreatic cancer (3)
- Progesterone-mediated oocyte maturation (3)
- Proteasome (3)
- Purine metabolism (3)
- TGF-beta signaling pathway (3)
- Acute myeloid leukemia (2)
- Alzheimer's disease (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- Bladder cancer (2)
- Cysteine and methionine metabolism (2)
- Drug metabolism - other enzymes (2)
- ErbB signaling pathway (2)
- Focal adhesion (2)
- Leukocyte transendothelial migration (2)
- O-Glycan biosynthesis (2)
- Propanoate metabolism (2)
- Prostate cancer (2)
- RIG-I-like receptor signaling pathway (2)
- Regulation of actin cytoskeleton (2)
- Spliceosome (2)
- Systemic lupus erythematosus (2)
- Thyroid cancer (2)
- Tight junction (2)
- Adipocytokine signaling pathway (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Arachidonic acid metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Axon guidance (1)
- Basal cell carcinoma (1)
- Basal transcription factors (1)
- Biosynthesis of unsaturated fatty acids (1)
- Cell adhesion molecules (CAMs) (1)
- DNA replication (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Fc epsilon RI signaling pathway (1)
- Glioma (1)
- Glutathione metabolism (1)
- Glycolysis / Gluconeogenesis (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glyoxylate and dicarboxylate metabolism (1)
- GnRH signaling pathway (1)
- Insulin signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Keratan sulfate biosynthesis (1)
- Limonene and pinene degradation (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysine degradation (1)
- Lysosome (1)
- Melanogenesis (1)
- Melanoma (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Neuroactive ligand-receptor interaction (1)
- Neurotrophin signaling pathway (1)
- Non-small cell lung cancer (1)
- Oocyte meiosis (1)
- Pathogenic Escherichia coli infection (1)
- Pentose phosphate pathway (1)
- RNA degradation (1)
- Regulation of autophagy (1)
- Renal cell carcinoma (1)
- Ribosome (1)
- Small cell lung cancer (1)
- T cell receptor signaling pathway (1)
- Terpenoid backbone biosynthesis (1)
- Toll-like receptor signaling pathway (1)
- VEGF signaling pathway (1)
- Valine (1)
- Vibrio cholerae infection (1)
- leucine and isoleucine degradation (1)