Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Polyclonal Antibody against PROX1 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PROX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-214 amino acids from the Central region of human PROX1. |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Conjugates
- Unconjugated
Families
- ES Cell Differentiation/IPS
Citations
- Yes
Filter by
Target Symbol
- GAPDH (15)
- CD4 (8)
- ACTB (7)
- CDH2 (7)
- PECAM1 (7)
- VIM (7)
- MAPK8 (6)
- CTNNB1 (5)
- NCAM1 (5)
- CD44 (4)
- CDX2 (4)
- GATA4 (4)
- MKI67 (4)
- ABCG2 (3)
- AKT1 (3)
- BCL2 (3)
- CD8A (3)
- CDH1 (3)
- EPCAM (3)
- GFAP (3)
- MAPK3 (3)
- NOTCH1 (3)
- ACTN1 (2)
- AKT3 (2)
- BCL2L1 (2)
- BDNF (2)
- BSG (2)
- CASP3 (2)
- CD34 (2)
- CDH5 (2)
- EGFR (2)
- ENG (2)
- FN1 (2)
- G6PC (2)
- ICAM1 (2)
- KDR (2)
- KRT7 (2)
- L1CAM (2)
- LAMP2 (2)
- PDX1 (2)
- PLAU (2)
- PRNP (2)
- PTCH1 (2)
- SERPINA1 (2)
- SLC2A1 (2)
- SMURF2 (2)
- SOX9 (2)
- STAT5A (2)
- TGFB1 (2)
- TNNI3 (2)
- ANPEP (1)
- BST2 (1)
- CD81 (1)
- CDCP1 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- DKK1 (1)
- FGF21 (1)
- GATA3 (1)
- GLI1 (1)
- GLI2 (1)
- GREM1 (1)
- HCRTR1 (1)
- HNF4A (1)
- ITGA2B (1)
- ITGA4 (1)
- JMJD6 (1)
- LAMP1 (1)
- MCAM (1)
- NANOG (1)
- NECTIN1 (1)
- NEUROD1 (1)
- PROM1 (1)
- PROX1 (1)
- SMAD3 (1)
- SOX2 (1)
- TNFRSF8 (1)
- TUBB3 (1)
- WNT2 (1)
Reactivities
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (47)
- Cell adhesion molecules (CAMs) (45)
- Focal adhesion (39)
- Colorectal cancer (29)
- Leukocyte transendothelial migration (26)
- Adherens junction (24)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (23)
- MAPK signaling pathway (23)
- Pancreatic cancer (21)
- Alzheimer's disease (20)
- Hematopoietic cell lineage (20)
- Metabolic pathways (20)
- Neurotrophin signaling pathway (19)
- Regulation of actin cytoskeleton (19)
- T cell receptor signaling pathway (19)
- Tight junction (19)
- Endometrial cancer (18)
- ErbB signaling pathway (18)
- Prostate cancer (18)
- Glycolysis / Gluconeogenesis (17)
- Insulin signaling pathway (16)
- Pathogenic Escherichia coli infection (16)
- Adipocytokine signaling pathway (15)
- Chronic myeloid leukemia (15)
- Fc epsilon RI signaling pathway (14)
- Melanoma (14)
- Progesterone-mediated oocyte maturation (14)
- Toll-like receptor signaling pathway (14)
- Wnt signaling pathway (14)
- Antigen processing and presentation (13)
- Dilated cardiomyopathy (13)
- Hypertrophic cardiomyopathy (HCM) (13)
- Prion diseases (13)
- Small cell lung cancer (13)
- Viral myocarditis (13)
- Apoptosis (12)
- Renal cell carcinoma (12)
- GnRH signaling pathway (11)
- Primary immunodeficiency (11)
- Thyroid cancer (11)
- Type II diabetes mellitus (11)
- Acute myeloid leukemia (10)
- Basal cell carcinoma (10)
- Epithelial cell signaling in Helicobacter pylori infection (10)
- Glioma (10)
- Non-small cell lung cancer (10)
- VEGF signaling pathway (10)
- B cell receptor signaling pathway (9)
- Jak-STAT signaling pathway (9)
- Melanogenesis (9)
- NOD-like receptor signaling pathway (9)
- Bladder cancer (8)
- Chemokine signaling pathway (8)
- Dorso-ventral axis formation (8)
- ECM-receptor interaction (8)
- Fc gamma R-mediated phagocytosis (8)
- TGF-beta signaling pathway (8)
- mTOR signaling pathway (8)
- Amyotrophic lateral sclerosis (ALS) (7)
- Cytokine-cytokine receptor interaction (7)
- Natural killer cell mediated cytotoxicity (7)
- Vibrio cholerae infection (7)
- Endocytosis (6)
- Gap junction (6)
- RIG-I-like receptor signaling pathway (6)
- Axon guidance (5)
- Hedgehog signaling pathway (5)
- Complement and coagulation cascades (4)
- Huntington's disease (4)
- Maturity onset diabetes of the young (4)
- ABC transporters (3)
- Cell cycle (3)
- Long-term depression (3)
- Long-term potentiation (3)
- Lysosome (3)
- Notch signaling pathway (3)
- Oocyte meiosis (3)
- Vascular smooth muscle contraction (3)
- Allograft rejection (2)
- Autoimmune thyroid disease (2)
- Calcium signaling pathway (2)
- Cardiac muscle contraction (2)
- Galactose metabolism (2)
- Graft-versus-host disease (2)
- Parkinson's disease (2)
- Starch and sucrose metabolism (2)
- Systemic lupus erythematosus (2)
- Type I diabetes mellitus (2)
- Ubiquitin mediated proteolysis (2)
- p53 signaling pathway (2)
- Drug metabolism - cytochrome P450 (1)
- Drug metabolism - other enzymes (1)
- Glutathione metabolism (1)
- Linoleic acid metabolism (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Neuroactive ligand-receptor interaction (1)
- PPAR signaling pathway (1)
- Primary bile acid biosynthesis (1)
- Renin-angiotensin system (1)
- Retinol metabolism (1)