Germany
Japan
United Kingdom
China
Antibodies
Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Anti-VTN Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VTN antibody: synthetic peptide directed towards the N terminal of human VTN. Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Focal adhesion
Filter by
Target Symbol
- EGFR (55)
- AKT1 (53)
- CTNNB1 (30)
- ERBB2 (26)
- JUN (26)
- KDR (26)
- RAF1 (24)
- PXN (22)
- SRC (22)
- MAP2K1 (21)
- MAPK8 (20)
- MET (20)
- PTK2 (19)
- VASP (18)
- BCL2 (17)
- PAK1 (17)
- BAD (16)
- GSK3B (16)
- PDGFRB (16)
- PRKCA (16)
- BRAF (15)
- IGF1R (15)
- MAPK3 (14)
- ROCK2 (14)
- EGF (13)
- MAPK1 (13)
- PTEN (13)
- AKT2 (12)
- CCND1 (12)
- PRKCB (12)
- CAV1 (11)
- PDGFB (11)
- PIK3R1 (11)
- SHC1 (11)
- SPP1 (11)
- VEGFA (11)
- COL5A1 (10)
- FYN (10)
- IGF1 (10)
- ITGB3 (10)
- VCL (10)
- ELK1 (9)
- GRB2 (9)
- VAV1 (9)
- VEGFB (9)
- BCAR1 (8)
- ITGA4 (8)
- PDGFRA (8)
- CAV2 (7)
- COL1A1 (7)
- PAK2 (7)
- PDGFA (7)
- PDPK1 (7)
- PGF (7)
- RHOA (7)
- XIAP (7)
- ACTN1 (6)
- AKT3 (6)
- CCND3 (6)
- COL1A2 (6)
- FLT1 (6)
- ITGAV (6)
- ITGB1 (6)
- ITGB4 (6)
- PAK4 (6)
- PPP1CC (6)
- PRKCG (6)
- ACTN4 (5)
- BIRC2 (5)
- CCND2 (5)
- CDC42 (5)
- ILK (5)
- ITGA5 (5)
- ITGA6 (5)
- ITGB5 (5)
- MAPK9 (5)
- PAK3 (5)
- PAK5 (5)
- PPP1CA (5)
- PPP1CB (5)
- RAC1 (5)
- RAP1A (5)
- CAV3 (4)
- CRK (4)
- CRKL (4)
- DIAPH1 (4)
- DOCK1 (4)
- HGF (4)
- HRAS (4)
- LAMA4 (4)
- LAMC1 (4)
- MAPK10 (4)
- PDGFC (4)
- PIK3CA (4)
- PIK3R3 (4)
- PPP1R12A (4)
- RAP1B (4)
- ROCK1 (4)
- VAV3 (4)
- VEGFC (4)
Reactivities
- Human (870)
- Mouse (710)
- Rat (626)
- Bovine (30)
- Dog (26)
- Chicken (25)
- Pig (19)
- Cow (12)
- Monkey (10)
- Xenopus (10)
- Rabbit (9)
- Canine (8)
- Canis (8)
- Rhesus Monkey (7)
- Hamster (5)
- Drosophila (4)
- X. tropicalis (4)
- Sheep (3)
- C. elegans (2)
- Guinea Pig (2)
- Zebrafish (2)
- Feline (1)
- Horse (1)
- Porcine (1)
- Primate (1)
- Tobacco hornworm (1)