Germany
Japan
United Kingdom
China
Antibodies
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Antibody against SLC29A1 (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 234-263 amino acids from the Central region of human ENT1. |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Anti-CD36 mouse mAb, clone OTI4H7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Rabbit |
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Anti-CD36 mouse mAb, clone OTI3F4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-CD36 mouse mAb, clone OTI3F4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Anti-CD36 mouse mAb, clone OTI4H7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Adenosine Receptor A2a (ADORA2A) (full length) Mouse Monoclonal Antibody [Clone ID: 7F6-G5-A2 / 7F6]
USD 440.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
| Applications | FC, IHC, WB |
| Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
USD 480.00
2 Weeks
ENPP2 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ENPP2 |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Active filters
Applications
- WB
Families
- Transmembrane
Filter by
Target Symbol
- KLK8 (243)
- CD4 (202)
- EGFR (156)
- PDCD1 (156)
- ERBB2 (153)
- ABCB1 (124)
- PECAM1 (122)
- HAVCR2 (121)
- MSMB (120)
- CD68 (118)
- CD5 (114)
- CD274 (111)
- CD99 (107)
- APP (94)
- EPCAM (94)
- L1CAM (94)
- MLANA (93)
- CD80 (88)
- BCL2 (86)
- KIT (74)
- PROCR (74)
- CD27 (73)
- CD44 (72)
- SPG7 (72)
- CD33 (69)
- NCAM1 (68)
- PDCD1LG2 (68)
- BSG (66)
- TNFRSF8 (66)
- BTLA (65)
- CD19 (65)
- PTPRC (65)
- FCGR2A (63)
- LGR5 (63)
- SYP (63)
- CD63 (61)
- RET (61)
- CD40 (60)
- MET (60)
- MCL1 (59)
- CDH1 (58)
- FGG (58)
- NPR3 (58)
- CD163 (57)
- CD86 (57)
- PDGFRA (57)
- MSR1 (55)
- PTPRE (55)
- MS4A1 (54)
- CD1C (53)
- CYP1A2 (51)
- ERBB3 (51)
- FBXW7 (51)
- PCDH7 (51)
- RPN1 (51)
- BTN1A1 (50)
- CD22 (50)
- FGFR2 (50)
- PDIA4 (50)
- SLC2A5 (50)
- APMAP (48)
- HP (48)
- MTDH (48)
- MUC1 (48)
- LRRC25 (47)
- POR (47)
- WNT3 (47)
- LAG3 (46)
- TAPBPL (46)
- UBE2J1 (46)
- VCAM1 (46)
- FATE1 (45)
- GOLM1 (45)
- MSLN (45)
- CD34 (44)
- ENPEP (44)
- GPNMB (44)
- HMOX2 (44)
- ACE2 (43)
- FOLH1 (43)
- CD2 (42)
- CD79B (42)
- CDH2 (42)
- KCNJ3 (42)
- KDR (42)
- TMEFF2 (42)
- ICAM3 (41)
- NEU1 (41)
- PDGFRB (41)
- POMK (41)
- SYT4 (41)
- FXYD3 (40)
- TPSG1 (40)
- CDCP1 (39)
- CYP2J2 (39)
- FCER2 (39)
- BNIP1 (38)
- FGFR1 (38)
- TNF (38)
- VIP (38)
Reactivities
- Human (18154)
- Mouse (6919)
- Rat (6207)
- Dog (613)
- Monkey (512)
- Cow (129)
- Bovine (120)
- Pig (102)
- Canine (51)
- Primate (42)
- Rabbit (41)
- Chicken (37)
- Rhesus Monkey (28)
- Hamster (25)
- Xenopus (21)
- Porcine (20)
- Sheep (19)
- Chimpanzee (16)
- Zebrafish (15)
- Guinea Pig (11)
- X. tropicalis (9)
- Drosophila (7)
- Macaque (7)
- Equine (5)
- Feline (5)
- Goat (3)
- Quail (3)
- Avian (2)
- Fish (2)
- Opossum (2)
- Canis (1)
- Eukaryote (1)
- Mink (1)
- Murine (1)
- Mustelid (1)
- Squirrel (1)
Antibody Hosts
Isotypes
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Cell adhesion molecules (CAMs) (2157)
- Cytokine-cytokine receptor interaction (1937)
- Hematopoietic cell lineage (1461)
- Pathways in cancer (1406)
- Metabolic pathways (1098)
- Neuroactive ligand-receptor interaction (913)
- Endocytosis (854)
- Calcium signaling pathway (835)
- Focal adhesion (814)
- Prostate cancer (637)
- MAPK signaling pathway (596)
- Adherens junction (588)
- Regulation of actin cytoskeleton (586)
- T cell receptor signaling pathway (573)
- Colorectal cancer (537)
- Leukocyte transendothelial migration (523)
- Melanoma (499)
- ErbB signaling pathway (462)
- Primary immunodeficiency (460)
- Systemic lupus erythematosus (445)
- Bladder cancer (423)
- Jak-STAT signaling pathway (418)
- Olfactory transduction (416)
- Toll-like receptor signaling pathway (416)
- Pancreatic cancer (398)
- Endometrial cancer (391)
- Alzheimer's disease (380)
- Viral myocarditis (372)
- Apoptosis (371)
- Antigen processing and presentation (369)
- Axon guidance (357)
- Allograft rejection (356)
- Gap junction (353)
- Lysosome (345)
- Autoimmune thyroid disease (343)
- Non-small cell lung cancer (336)
- Epithelial cell signaling in Helicobacter pylori infection (333)
- Natural killer cell mediated cytotoxicity (309)
- Glioma (306)
- Graft-versus-host disease (299)
- Type I diabetes mellitus (295)
- Melanogenesis (267)
- ABC transporters (264)
- Amyotrophic lateral sclerosis (ALS) (252)
- ECM-receptor interaction (227)
- Neurotrophin signaling pathway (227)
- GnRH signaling pathway (219)
- Dilated cardiomyopathy (209)
- Hypertrophic cardiomyopathy (HCM) (202)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (201)
- Fc gamma R-mediated phagocytosis (200)
- Drug metabolism - cytochrome P450 (199)
- Parkinson's disease (189)
- B cell receptor signaling pathway (187)
- SNARE interactions in vesicular transport (182)
- Basal cell carcinoma (181)
- Huntington's disease (175)
- Retinol metabolism (173)
- Renin-angiotensin system (171)
- Adipocytokine signaling pathway (165)
- Dorso-ventral axis formation (164)
- Asthma (163)
- Chemokine signaling pathway (163)
- Small cell lung cancer (153)
- Hedgehog signaling pathway (150)
- Tight junction (146)
- Linoleic acid metabolism (142)
- N-Glycan biosynthesis (138)
- Metabolism of xenobiotics by cytochrome P450 (136)
- TGF-beta signaling pathway (132)
- Pathogenic Escherichia coli infection (130)
- Wnt signaling pathway (130)
- Oxidative phosphorylation (129)
- Thyroid cancer (129)
- Complement and coagulation cascades (125)
- Prion diseases (125)
- Vascular smooth muscle contraction (113)
- Sphingolipid metabolism (112)
- PPAR signaling pathway (110)
- Arachidonic acid metabolism (109)
- RIG-I-like receptor signaling pathway (107)
- Ubiquitin mediated proteolysis (105)
- Tryptophan metabolism (104)
- Renal cell carcinoma (102)
- Vibrio cholerae infection (99)
- Fatty acid metabolism (98)
- Caffeine metabolism (97)
- Cardiac muscle contraction (96)
- Acute myeloid leukemia (94)
- Drug metabolism - other enzymes (90)
- Porphyrin and chlorophyll metabolism (84)
- Purine metabolism (83)
- p53 signaling pathway (78)
- Glycerolipid metabolism (77)
- NOD-like receptor signaling pathway (77)
- Notch signaling pathway (74)
- Long-term depression (73)
- Fc epsilon RI signaling pathway (69)
- Long-term potentiation (67)
- Chronic myeloid leukemia (62)
- Glycerophospholipid metabolism (62)
- Androgen and estrogen metabolism (61)
- Pyrimidine metabolism (60)
- Type II diabetes mellitus (60)
- Ascorbate and aldarate metabolism (57)
- Insulin signaling pathway (57)
- Cytosolic DNA-sensing pathway (53)
- Glycosphingolipid biosynthesis - lacto and neolacto series (53)
- Keratan sulfate biosynthesis (51)
- Nitrogen metabolism (51)
- VEGF signaling pathway (51)
- Progesterone-mediated oocyte maturation (50)
- Nicotinate and nicotinamide metabolism (47)
- O-Glycan biosynthesis (47)
- Taste transduction (47)
- Tyrosine metabolism (47)
- Glycolysis / Gluconeogenesis (44)
- Other glycan degradation (42)
- Propanoate metabolism (42)
- Valine (42)
- leucine and isoleucine degradation (42)
- Ether lipid metabolism (41)
- Oocyte meiosis (41)
- beta-Alanine metabolism (41)
- Arginine and proline metabolism (40)
- Glutathione metabolism (40)
- Histidine metabolism (40)
- Starch and sucrose metabolism (40)
- Lysine degradation (38)
- Limonene and pinene degradation (37)
- Butanoate metabolism (36)
- Pyruvate metabolism (36)
- Biosynthesis of unsaturated fatty acids (33)
- Riboflavin metabolism (33)
- Heparan sulfate biosynthesis (30)
- Primary bile acid biosynthesis (30)
- Chondroitin sulfate biosynthesis (28)
- Amino sugar and nucleotide sugar metabolism (27)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (25)
- Pentose and glucuronate interconversions (25)
- Glycosphingolipid biosynthesis - ganglio series (18)
- Galactose metabolism (15)
- Glycosphingolipid biosynthesis - globo series (15)
- Steroid biosynthesis (14)
- Glycosaminoglycan degradation (13)
- Glycine (11)
- Protein export (11)
- alpha-Linolenic acid metabolism (11)
- serine and threonine metabolism (11)
- C21-Steroid hormone metabolism (10)
- Cell cycle (10)
- Phenylalanine metabolism (10)
- Cyanoamino acid metabolism (8)
- Phosphatidylinositol signaling system (8)
- Selenoamino acid metabolism (8)
- Taurine and hypotaurine metabolism (8)
- Inositol phosphate metabolism (7)
- Base excision repair (5)
- O-Mannosyl glycan biosynthesis (5)
- Sulfur metabolism (5)
- Maturity onset diabetes of the young (2)
- Terpenoid backbone biosynthesis (2)
- Citrate cycle (TCA cycle) (1)
- Pantothenate and CoA biosynthesis (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)