JNK1 (MAPK8) mouse monoclonal antibody, clone 4H6, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 4H6, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 4H5, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
USD 450.00
In Stock
Rabbit Polyclonal Antibody against PIK3CG (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 518-547 amino acids from the Central region of human PI3KCG. |
Goat Polyclonal Antibody against SOCS3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PIREFLDQYDAPL, from the C Terminus of the protein sequence according to NP_003946.3. |
Rabbit Polyclonal SOCS1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SOCS1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human SOCS1. |
Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3 |
Rabbit polyclonal PKCd (Ser645) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKCd around the phosphorylation site of serine 645 (R-L-SP-Y-S). |
Modifications | Phospho-specific |
Rabbit polyclonal IRS-1 (Ab-307) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 307 (T-E-S-I-T). |
Rabbit polyclonal IRS-1 (Ser312) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A) |
Modifications | Phospho-specific |
Anti-MAPK10 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 416-428 amino acids of Human mitogen-activated protein kinase 10 |
Rabbit polyclonal GCK Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK. |
Rabbit Polyclonal ERK1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha/ gamma (Tyr467/199) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha/ gamma around the phosphorylation site of Tyrosine 467/199 |
Modifications | Phospho-specific |
USD 345.00
In Stock
Rabbit polyclonal PIK3CG antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PIK3CG. |
Rabbit anti-JNK2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human JNK2 |
MAPK10 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAPK10 |
Rabbit anti-PDX1 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PDX1 |
Rabbit anti-Phospho-MAPK8/9/10-T183/Y185 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T183/Y185 of human MAPK8/MAPK9/MAPK10 |
Rabbit anti-KCNJ11 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KCNJ11 |
Mouse Monoclonal IKK beta Antibody (10AG2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PKM2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the N terminal of human PKM2. Synthetic peptide located within the following region: MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICT |
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |
Rabbit Polyclonal Anti-SOCS1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the middle region of human SOCS1. Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA |
Mouse Monoclonal IKKβ Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAPK1/3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAPK1/3 Antibody: A synthesized peptide derived from human MAPK1/3 |
Rabbit Polyclonal Anti-PKM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PKM2 Antibody: Peptide sequence around aa.405~409(T-S-D-P-T) derived from Human PKM2. |
Rabbit Polyclonal Anti-PI3-kinase p85-alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PI3-kinase p85-alpha Antibody: A synthesized peptide derived from human PI3-kinase p85-alpha |
Rabbit Polyclonal PKC zeta Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal PKC epsilon Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Goat Polyclonal Anti-TNF alpha Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Goat Polyclonal Anti-INS Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human Insulin produced in E. coli as a fusion protein. |
Goat Polyclonal Anti-INSR Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 1310 aa to the C-terminus of human INSR produced in E. coli. |
USD 465.00
2 Weeks
ERK2 (MAPK1) (C-term) (incl. pos. control) mouse monoclonal antibody, clone 6G11, Biotin
Applications | ELISA, IP, WB |
Reactivities | Canine, Human, Mouse, Rat |
Conjugation | Biotin |
ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
ERK1 (MAPK3) mouse monoclonal antibody, clone AT1A2, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
ERK1 (MAPK3) mouse monoclonal antibody, clone AT1A2, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
JNK2 (MAPK9) (1-425) mouse monoclonal antibody, clone 1C1-3A8, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 1E1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 1A2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 3B12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
JNK1 (MAPK8) mouse monoclonal antibody, clone 1E2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
USD 370.00
2 Weeks
PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
JNK1 (MAPK8) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 380-420 of Human JNK3. |
IRS1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
MTOR rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
JNK1 (MAPK8) (+JNK2/3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 370.00
2 Weeks
PI 3 Kinase p85 alpha (PIK3R1) pTyr458/199 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |