Rabbit polyclonal TXN Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TXN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-94 amino acids from the C-terminal region of human TXN. |
Rabbit polyclonal PITPNA Antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PITPNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-270 amino acids from the C-terminal region of human PITPNA. |
Rabbit polyclonal PTGER4 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PTGER4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 242-269 amino acids from the Central region of human PTGER4. |
Rabbit polyclonal PPP2R2A Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PPP2R2A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-71 amino acids from the N-terminal region of human PPP2R2A. |
Mouse monoclonal Erp57 (Grp58) Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
Rabbit polyclonal Hsp60 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human Hsp60 produced through recombinant DNA methods in E.coli |
Mouse monoclonal p23 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Chicken, Guinea pig, S. cerevisiae (lower) |
| Conjugation | Unconjugated |
Mouse monoclonal GRP94 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig, Horse |
| Conjugation | Unconjugated |
Rabbit polyclonal Akt2 (PKB beta) Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | A five residue synthetic peptide based on the human Akt2, coupled to KLH |
Rabbit Polyclonal Anti-Calnexin -CT Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak) |
| Conjugation | Unconjugated |
| Immunogen | Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rat Monoclonal Anti-HSF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Guinea Pig, Hamster, Monkey, Rabbit. Dog, Bovine, Sheep, Pig |
| Conjugation | Unconjugated |
Rat Monoclonal Anti-TCP1 alpha Antibody
| Applications | WB |
| Reactivities | Hamster, Mouse, Rabbit, Rat, Sheep, Dog, Cow |
| Conjugation | Unconjugated |
Mouse Monoclonal anti-TIMP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Chicken, Zebrafish |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-PLN antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLN antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 1-22 amino acids from the N-terminal region of human PLN. |
USD 450.00
5 Days
Mouse monoclonal anti-ACHE antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-BLMH antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This BLMH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 212-242 amino acids from the Central region of human BLMH. |
Rabbit polyclonal anti-R Csnk2a1 antibody (N-term)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This Rat Csnk2a1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-50 amino acids from the N-terminal region of Rat Csnk2a1. |
Rabbit Polyclonal Anti-SIAH3 Antibody
| Applications | WB |
| Reactivities | Human, Rabbit, Dog, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA |
Mouse Monoclonal cleaved ROCK1 Antibody (154C1465)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine, Primate, Rabbit |
| Conjugation | Unconjugated |
Rabbit Polyclonal Tmp21/p23 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate, Rabbit, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal sequence of the human TMP21 protein (within residues 50-150). [Swiss-Prot# P49755] |
Rabbit Polyclonal Potassium Channel Kv3.1 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of rat Kv3.1 (within residues 350-400). [Swiss-Prot# P25122] |
Rabbit Polyclonal Anti-beta-Actin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin. |
Rabbit Polyclonal Anti-beta-Actin Antibody (HRP)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | HRP-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin. |
Rabbit Polyclonal Anti-GAPDH Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-GAPDH antibody was raised against a synthetic peptide containing 16 amino acids near the carboxy terminus of GAPDH. |
Rabbit Polyclonal Anti-GAPDH Antibody (HRP)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | HRP-GAPDH antibody was raised against a synthetic peptide containing 16 amino acids near the carboxy terminus of GAPDH. |
Rabbit Polyclonal Anti-Alpha-tubulin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Alpha-tubulin antibody was raised against an 18 amino acid peptide near the carboxy terminus of human alpha-tubulin |
Rabbit Polyclonal Anti-Vinculin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Vinculin antibody was raised against a 23 amino acid peptide near the amino terminus of human Vinculin. |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7]
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7] (biotin)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-GAPDH Antibody [12D3D5] (biotin)
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-Vinculin Antibody [8B5]
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Recombinant Anti-p53 (Clone PAb421)
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Recombinant Anti-p53 (Clone PAb421)
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-Syntaxin (Clone SP6)
| Applications | IHC, WB |
| Reactivities | Guinea Pig, Hamster, Human, Rabbit, Rat, Dog, Pig, Cow |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CDCrel-1 (Clone SP18)
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Rabbit, Rat |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD44 (Clone Hermes-1)
| Applications | Bl, ELISA, FC, IF, IHC, IP, Neutralize, WB |
| Reactivities | Bovine, Goat, Human, Mouse, Primate, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD44 (Clone Hermes-1)
| Applications | Bl, ELISA, FC, IF, IHC, IP, Neutralize, WB |
| Reactivities | Bovine, Goat, Human, Mouse, Primate, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
Recombinant Anti-CD257 (BAFF) (Clone Tabalumab)
| Applications | ELISA, FC, IF, IP, Neutralize, WB |
| Reactivities | Human, Monkey, Rabbit |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-C5aR (Clone S5/1)
| Applications | Bl, ELISA, FC, IP, WB |
| Reactivities | Ferret, Human, Rabbit, Cow |
| Conjugation | Unconjugated |
Recombinant Anti-C5aR (Clone S5/1)
| Applications | Bl, ELISA, FC, IP, WB |
| Reactivities | Ferret, Human, Rabbit, Cow |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Anti-Connexin 35/36 (Ser276) Antibody
| Applications | IHC, WB |
| Reactivities | Fish, Mouse, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues of perch connexin 35/36 surrounding Ser276, conjugated to keyhole limpet hemocyanin (KLH). |
Anti-FAK (Tyr-397), Phosphospecific Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
